KEGG   Rhizobium etli CFN 42: RHE_CH00671Help
Entry
RHE_CH00671       CDS       T00317                                 

Gene name
flaCch3
Definition
(GenBank) flagellin C protein
  KO
K02406  flagellin
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02020  Two-component system
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHE_CH00671 (flaCch3)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    RHE_CH00671 (flaCch3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00671 (flaCch3)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00671 (flaCch3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C NPM1-C
Motif
Other DBs
NCBI-ProteinID: ABC89487
RhizoBase: RHE_CH00671
UniProt: Q2KCE9
Position
689937..690848
Genome map
AA seq 303 aa AA seqDB search
MTSILTNVAAMAALQTLRGINDSLEGTQNRVSSGYRVEKASDNAAYWSIATTMRSDNKAL
SAVSDALGLGAAKVDTAYSAMDSAIDVISEIKAKIVAATEKGVDKTKVQEEIGQLQQQLL
SIAQSASFSGENWVAGADGTKSVVSTFVRDGNGNVSVKTTDYVLDTSSTGNVLFGMTSTG
TIETTSGIIGTSYGTIGSIYSMDISTFGSAEISMALTSIEAGLEAMTKAASQLGSISTRI
ELQENFVGALSDSIDSGVGRLVDADMEEESSKLTALQTQQQLAIQSLSIANSSAQNILTL
FRS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcattttgacgaacgtcgcggcgatggccgctcttcagacactccgcggaatc
aatgacagcctcgaaggcacgcagaaccgcgtctcgtcgggttatcgcgtcgaaaaggcg
tccgacaacgccgcctactggtcgatcgcaacgaccatgcgttcggacaacaaggcgctt
tcggccgtatccgacgctctcggtctcggcgccgccaaggtcgacactgcctactccgcc
atggacagcgccattgacgtcatcagcgagatcaaggcgaaaatcgttgccgcaaccgaa
aagggcgtcgacaagaccaaggtccaggaggaaatcggccagctgcagcagcagcttctg
agcatcgcgcagtcggcttccttctccggcgaaaactgggtcgccggcgccgatggcacc
aagagcgtcgtgtcgaccttcgtccgcgacggcaatggcaatgtttcggtcaagaccact
gactacgtcctggacacgagctccactggcaacgtgctctttggcatgacctcgacgggc
accatcgagacgacctccggcattatcggcacgtcctacggcacgatcggctcgatctat
tcgatggacatcagcaccttcggttcggccgagatatccatggcactgacgtcgattgag
gctggcctggaggcgatgaccaaggctgcctcgcagctcggttcgatttccacccgtatc
gaattgcaggaaaacttcgtcggagcgctcagcgattcgatcgactcgggcgtcggccgc
ctcgtcgatgccgacatggaagaggaatcaagcaagctgacggcgttgcaaacccagcag
cagctggcgattcagtcgctgtcgatcgccaactccagcgcgcagaacatcctcaccctg
ttccgcagctaa

DBGET integrated database retrieval system