KEGG   Rhizobium etli CFN 42: RHE_CH00673Help
Entry
RHE_CH00673       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3391
Motif
Other DBs
NCBI-ProteinID: ABC89489
RhizoBase: RHE_CH00673
UniProt: Q2KCE7
Position
692313..692942
Genome map
AA seq 209 aa AA seqDB search
MSISLSRYLKDFGEPKPSAPIIDIDDLAGDVFPETPSEPPVDVEAERREAYAQGHAAATA
DLTEKYEGEARALAEAHARALEELKIRYEVEAAAVIASRVRDIAEEVAQLVSAGAAIAIA
PVVTDALAAKAAESLAALLREAILEGAAGPIVVRGPTGLFDILKAELGEHAAAVRHIEAD
DVDLAVEIGESVIVTRMSAWVASLKKVLE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttcgctttctcggtatttgaaggacttcggcgaaccgaagccgtcagcgccg
atcatcgatatcgacgatttggccggagatgtttttccggagacgccgagcgaaccgccg
gtcgacgtcgaggcggagcgtcgcgaagcctatgcgcaaggccatgccgcggcgaccgct
gatttgaccgagaaatatgaaggcgaggcgcgcgcgctggccgaggcgcatgcgcgcgcg
ctcgaggaactgaagattcgctatgaagtggaggcggcggcggtcattgcatcccgcgtc
cgcgatatcgccgaagaagtcgctcagctggtcagcgccggcgcggcgatcgccattgcg
cccgtcgtgacggacgcgcttgcggccaaggctgccgaaagtctcgccgctttgctgcgt
gaagcgattctcgaaggcgcggccggaccaatcgtcgtcagagggccgaccggccttttc
gacatattgaaagccgagctgggcgaacatgccgcggcggttcggcacatcgaggccgac
gatgtcgatcttgccgtcgaaatcggtgaatccgttatcgtcacccgtatgtccgcctgg
gtggccagcctgaagaaagttctcgaatga

DBGET integrated database retrieval system