KEGG   Rhizobium etli CFN 42: RHE_CH00680Help
Entry
RHE_CH00680       CDS       T00317                                 

Gene name
flgKch
Definition
(GenBank) flagellar hook-associated protein
  KO
K02396  flagellar hook-associated protein 1 FlgK
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    RHE_CH00680 (flgKch)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00680 (flgKch)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Peptidase_M41 Tropomyosin Syntaxin-6_N DUF3450
Motif
Other DBs
NCBI-ProteinID: ABC89496
RhizoBase: RHE_CH00680
UniProt: Q2KCE0
Position
699890..701377
Genome map
AA seq 495 aa AA seqDB search
MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSLNGAQVVKIDRAQE
DALLRQYLKSSSQDSAQQTLLSGLEDLKSIMGGNDYETSPSTYLGVFQQKLQAFRTSPGS
TVAAQGAITAAQDVANSLNNASQSVQDVRANADKEIATAVDTLNTLLSEFEKANNAVKTA
TATGADTSGALDEREKVLKQISQIVGVSATTRDNNDMVLSTPDGTILFETIPRKVTFKSQ
DIYTATTVGNSVYIDGVALPLGKGSTTTGQGSLQSLLQIRDEIAPNFQKQLDETARGLVS
LFKEQNTAGPPAYVPGLFTWSGGTVDTGATAVAGMASTITVSTRVITSQGGDPMRLRDGG
VNAAGVVLNTSGVSGYTAELDRLYTAMTSDMDFDPAAGAPVGFDATTGIDSNVSIMEYAT
NSLGWLEQYRSNATTAAENTAAALSRSDEAYSNETGVNLDEELTLLLDIEQSYKAATKIL
NAVDEMLKSLLDIAS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacgtccgcacttaacaccgcgcagaacatattcaacaataccggcacgcag
agcagtgtcgtatcgaacaatatctcgaatgcgggcaacaaggactacgtgcgccgccag
gcgatgctcaccacgtcactgaacggcgcgcaggtggtcaagatagaccgggcccaggaa
gatgccctgctgcgccagtatctgaagtcatcctctcaggacagcgctcagcagaccctg
ctgagcggtctggaggatctcaagtcgattatgggcggcaacgactatgaaacgtcgccc
tccacctatctcggcgttttccagcagaagctgcaggccttcagaacctctccgggcagc
acggtcgccgcccagggtgccatcacagccgcccaggacgtcgccaactccttgaacaat
gcctcgcaatccgttcaggatgtccgcgccaacgccgacaaggaaatagccaccgcggtc
gatacgctgaacacgcttctcagcgagttcgagaaggccaataacgcggtcaagaccgcg
acggccacaggtgcggatacatccggcgctctcgatgaacgggagaaagtcctgaagcag
atttcgcagatcgtcggcgtcagcgcgacgacgcgcgacaacaacgacatggtgctgagc
acgccggacggaacgatcctcttcgagacgatcccgcgcaaggtgacgttcaagtcccag
gatatctatacagccaccaccgtcggcaattccgtctatatcgacggtgttgcgctgccg
ctcggtaagggttcgacgacgacggggcaggggagcctccagtcactcctgcagatccgt
gatgagatcgcccccaattttcagaagcagctcgacgaaaccgcccgtggcctcgtttcg
ctcttcaaggagcagaacacggcagggcccccggcctatgtgcccggcctcttcacctgg
agcggcggcacggtcgacaccggcgccaccgcggtcgccggcatggcgtcgaccatcaca
gtcagcacccgcgtgatcacctcgcagggcggtgacccgatgcgcctgcgcgatggcggc
gtcaacgccgccggcgtcgtcttgaacacgtcgggcgtcagcggctatacggctgaactc
gaccgtctctatacggcgatgacatccgacatggatttcgacccggcagctggagcgccg
gtcggcttcgacgccacgacgggcatcgattccaacgtcagcatcatggagtatgccacc
aattccctcggctggctcgagcagtaccgcagcaacgcaacgacggcggccgaaaacacc
gcggcggcactgtcacgctccgacgaagcctattccaatgagaccggcgtcaacctcgac
gaggagctgacgctgctcctcgatatcgagcagtcctacaaggcggcgaccaagatcctg
aacgccgtagacgaaatgttgaagtcattgctggatattgcgagttaa

DBGET integrated database retrieval system