KEGG   Rhizobium etli CFN 42: RHE_CH00682Help
Entry
RHE_CH00682       CDS       T00317                                 

Gene name
flaF
Definition
(GenBank) flagellin synthesis regulator protein
  KO
K06602  flagellar protein FlaF
Organism
ret  Rhizobium etli CFN 42
Brite
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00682 (flaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlaF
Motif
Other DBs
NCBI-ProteinID: ABC89498
RhizoBase: RHE_CH00682
UniProt: Q2KCD8
Position
702470..702817
Genome map
AA seq 115 aa AA seqDB search
MYQFSYAEVMQDSVADAKEREWQVLDRSIELLSLARDKEKYGREAIEALFYTRRVWISFI
EDLKHPDNQLDVQLRANLISIAIWILKECDRIRKRLSNNYQGIIDVTTIIRDGLK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagttctcatatgccgaggtcatgcaggactcggtggccgacgcgaaagagcgg
gaatggcaggttctcgaccggtccatagaactgctgtcgttggcgcgcgacaaggaaaaa
tacggtcgggaagccattgaagctctgttttatacgcgccgggtatggatcagctttatc
gaggatctgaaacatccagataaccagctggatgtccagctcagggccaacctcatctcg
attgcgatctggatattgaaggaatgcgacaggatcagaaaacgtctgtctaataactac
cagggcatcatcgacgttaccaccatcatcagggatggacttaaatga

DBGET integrated database retrieval system