KEGG   Rhizobium etli CFN 42: RHE_CH00686Help
Entry
RHE_CH00686       CDS       T00317                                 

Gene name
flhA
Definition
(GenBank) flagellar biosynthesis transmembrane protein
  KO
K02400  flagellar biosynthesis protein FlhA
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    RHE_CH00686 (flhA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ret02044]
    RHE_CH00686 (flhA)
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00686 (flhA)
Secretion system [BR:ret02044]
 Type III secretion system
  Flagellar export apparatus
   RHE_CH00686 (flhA)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    RHE_CH00686 (flhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHIPEP PTSIIA_gutA
Motif
Other DBs
NCBI-ProteinID: ABC89502
RhizoBase: RHE_CH00686
UniProt: Q2KCD4
Position
704174..706261
Genome map
AA seq 695 aa AA seqDB search
MAQPPALPLPKVAPSLRDIGFALGIIGIICILFLPIPPFLIDMGLAFSIAFSVLILMVAL
WIQKPLDFSSFPTILLIATMTRLALNIATTRVILSHGNEGHDAAGGVIAGFASLVMSGDF
VIGLIVFLILITINFIVITKGATRIAEVGARFTLDAIPGKQMSIDADLSAGIIDEKEAQR
RRRELEEESSFFGAMDGASKFVRGDAVAGLIITAINVFGGIIIGYFRHGMPIGEAADVFV
KLSVGDGLVSQMPALIVSLAAGLLVSRGGTTGSTDQAVVNQLSGYPRALSVSAVLMFVLG
LMPGLPTIPFTVLGGLLAFGAWFIPRQVEAENKLRREQEEKKVVQSKELEKDSVKSVLRT
SEIELALGKMVSTRLLGAHQELAFRVGKMRKKFATQYGFVVPEIKVTDDIAIAEKSYQIR
IHGTTVASNLLRVGEVLVVTGAGRKPSIPGDEIREPAFGMPAVSILENFADDLKREGFQP
IDNVSVVLTHMSEVIRNNLPQLLSYKDVKVLIDRLDPEYKKLADEICSSHMSYSGLQAVL
KLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEHVRIRMAQQLCGDLADNGVLRVLRL
GSKWDLAFHQALKRDAKGEVIEFDIDPRSLEEFSEQASKVIREFMDRGLPFALVTSPETR
SYVRMIIERLFATLPVLSHVELAKGIEIKILGSIS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaccacctgcactcccccttccgaaagtcgccccgagcctgcgcgatatcggt
tttgccctcggcatcatcggcatcatctgcattctcttcctgccgatcccgccgttcctg
atcgatatggggctggccttctcgatcgccttctcggtgctgatcctgatggtcgcgctg
tggatccagaagccgctcgacttctcgtcctttccgaccattctgctgatcgccacgatg
acacggctggcgctcaacatcgcgacgacccgcgtcatcctgtcccacggcaacgagggc
cacgatgcggccggcggcgttattgccggtttcgccagtctggtcatgtccggcgacttc
gtgatcggtctgatcgtcttcctgatcctcatcaccatcaacttcatcgtcatcaccaag
ggtgccacgcgtatcgccgaagtcggcgcccgtttcaccctcgatgccattcccggcaag
cagatgtcgatcgatgccgatctttcggccggcatcatcgatgagaaggaagcccagcgc
cggcgcagggagctcgaggaggaaagctccttcttcggggcgatggacggtgcctcgaaa
ttcgtgcgcggcgacgccgtcgccggtctcatcatcaccgcgatcaacgtcttcggcggc
atcatcatcggctatttccgtcatggcatgccgatcggtgaagcggctgacgtcttcgtc
aagctctccgtcggcgatggtctcgtctcgcagatgccggccctcatcgtctcgctcgcc
gccggccttctcgtgtcgcgcggcggcaccaccggctcaaccgaccaggcggtcgtcaat
cagctgagcggctatccccgcgcgctctccgtctcggccgtgctgatgttcgttctcggc
ctgatgccgggcctgccgaccattcccttcaccgtcctcggcggtcttctggccttcggc
gcctggttcattccgcggcaggtcgaggccgaaaacaagcttcgccgcgaacaggaggaa
aagaaggtcgtccagagcaaggaactggagaaggattcggtcaagtcggtgctccgcacc
tccgaaatcgagctcgcgctcggcaagatggtgtcgacccgcctgctcggcgcccatcag
gagctggcgttccgcgtcggcaagatgcgcaagaagttcgccacccaatacggtttcgtc
gtgccggaaatcaaggtcacggacgacatcgccatcgccgagaagtcctatcagatccgc
atccacggcacgacggtcgcatccaatctgctgcgcgtcggcgaagtcctcgtcgtcacc
ggcgccggtcgcaagcccagcattcccggcgacgaaatccgcgaacccgctttcggcatg
ccggccgtctcgatcctcgaaaacttcgccgacgacttgaagcgcgaaggcttccagccg
atcgacaacgtctccgtcgtgctcacgcacatgagcgaggtcatccgcaacaacctgccg
cagcttctgtcctacaaggacgtcaaggtgctgatcgatcgcctcgacccggaatacaag
aagctcgccgatgagatctgctcgtcgcatatgtcctattccggtctgcaggcggtgctc
aagctcctgcttgccgagcgggtgtcgatccgcaacctgcatctcattctcgaagcggta
gccgagcttgccccgcatgtccggaagaccgagcagatcgtcgagcatgtccgcatccgc
atggcccagcagctctgcggcgatctcgccgacaatggcgtattgcgtgtgctgcgcctc
ggcagcaaatgggatctcgccttccaccaggcgctgaagcgcgatgccaagggcgaagtg
atcgaattcgatatcgatccacgcagcctggaggaattcagcgagcaggccagcaaagtt
atccgtgagttcatggatcgcggcctgccattcgcccttgtcacgtcgccggaaacacgc
tcctatgtgcgtatgatcatcgaacggctgttcgccacgctcccggtcctgtcgcatgtc
gaattggccaagggcatcgagataaagattttgggctcgatttcatga

DBGET integrated database retrieval system