KEGG   Rhizobium etli CFN 42: RHE_CH00693Help
Entry
RHE_CH00693       CDS       T00317                                 

Definition
(GenBank) putative succinoglycan biosynthesis transport protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbaB_DNA_bd
Motif
Other DBs
NCBI-ProteinID: ABC89509
RhizoBase: RHE_CH00693
UniProt: Q2KCC7
Position
710357..712120
Genome map
AA seq 587 aa AA seqDB search
MYDSRARSSFLDRAAARPRAHDDPYRQSRSNGPDIALPEADLLRAISRVLEEQRMRAAPE
VPLVDRIETILGNRLRAANDVGRVLPPEPARYEEPVTTAGEPAIFVEPLAAIHQEPVEPR
PAAPQRRAGKAGFAVTVAASTILGAGLPMLMPAAPALYRAETTLAVITDAASRAAFTQAA
AKGLLSARVVASTVATLKLDHDPEFVGTGANALAVVFDLLSATGTAADPASRAEAALKHA
VEIVPDAAAGTIRVRVTTGDGAKSTRIAARLAEAAGGDARGGNAETDAVLRKAYDEARAE
LAAFTAKSGEGNVKVAIDLRRQIDRLDADLKEAEESILAAKAKADQLKAAKLADVLDGSL
SSDMTSPALQDWRDKYAVARAALAQLSAELGPRHPRLLQQQAETEGLKANMGKELARLAQ
VANAAAKAATDARKVLNDRRNTLIAQSRDTGVDLSRLTELREKANAAHSRLEEAASASGA
ADDGHITVLKPPLASAISATNGLTGRALAGAATGLAVGLALAFLLSLRKSVAAPAMDLPA
FAPVASPPPSPVPAPAAVDEIELMRSEISGLRDRLRVHVMETRQPRR
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatagcagggccagaagcagttttctcgatcgcgcagctgcaaggccgcgcgcc
catgacgatccctatcggcagtcccgatcgaacggaccggatatcgccctgcccgaagcc
gacctgctgcgcgccatcagccgtgtgctggaagagcagcgcatgagggcggcgcccgag
gtgccgctcgtcgaccgcatcgaaaccattctcggcaaccgtctgcgggctgccaatgat
gtcggccgtgttcttccgccggaaccagcgcgatatgaggaaccggtgactaccgccggg
gagccggcgatttttgtcgaaccgctggccgcaattcatcaggaaccggtcgagccccgg
ccggcggcaccgcaacgccgcgcgggcaaggccggcttcgcggtaacggtcgctgcctca
acaatcctgggcgccggtctgccgatgctgatgccggctgcgcccgccctctaccgcgcc
gaaacgacgcttgcagtgataacggatgccgcaagtcgcgccgctttcacgcaagctgcg
gcgaagggactgctgtcggcgcgcgtggttgcgtcgacggtcgccaccctgaagctcgat
cacgatcctgaattcgtcggcacgggcgccaatgcgctcgccgttgtgttcgatcttctc
tcggcgaccggcactgccgccgatccggcctcgcgtgccgaggccgcgctgaaacatgcg
gtcgagattgtgcccgatgccgccgccggcacgatccgggtgcgggtgacgaccggcgac
ggtgccaaatccacccgcatcgccgcaaggcttgccgaagcagcgggcggagacgcacga
ggcggcaacgccgaaaccgacgcggttttgcgcaaggcctatgacgaggctcgggcggag
cttgctgccttcacggcaaagagcggcgaaggcaacgtcaaggtggcgattgatcttcgc
cgccagatcgaccggctcgatgccgatctgaaagaggcggaggagagcatccttgccgcc
aaggcgaaggccgaccagctcaaggccgcaaaacttgccgatgtgctcgatggttcgctg
tcctccgatatgacttcgcctgcgctgcaggactggcgcgacaaatatgcggtcgccagg
gcggcgcttgcgcagctttccgccgagcttggcccgcgccatccgcgcctgctgcagcag
caggccgaaaccgagggcctgaaggcgaatatgggcaaggaacttgcccggctcgcccag
gtcgccaatgccgccgctaaggctgcgaccgatgcgcgcaaggtcctgaacgaccgccgc
aacacgctgatcgcccaaagccgggataccggcgtcgatctgtcacgactgaccgaactg
cgcgagaaggcgaatgccgcgcattcgcggctggaagaggcggcgtccgcatcgggggca
gccgacgacggtcatataaccgtgctgaagccgccgctggcgtcggcgatatcggcaacg
aacggtctgaccggccgcgcgctggccggcgccgccacaggcttggcagtcggtcttgcc
ctggctttcctgctgtccttgcgcaaatccgtcgcggctccggcaatggatttgccggcg
ttcgcgcccgtcgcttctccgccgccatcgcccgtgccggctccggcggcggtcgacgag
atcgagctgatgcgctccgaaatctcgggcctgcgcgatcggcttcgtgttcacgtgatg
gaaacgcggcaaccgcggcgctga

DBGET integrated database retrieval system