KEGG   Rhizobium etli CFN 42: RHE_CH00694Help
Entry
RHE_CH00694       CDS       T00317                                 

Gene name
folDch
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00670  One carbon pool by folate
ret01100  Metabolic pathways
ret01120  Microbial metabolism in diverse environments
ret01200  Carbon metabolism
Module
ret_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RHE_CH00694 (folDch)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     RHE_CH00694 (folDch)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     RHE_CH00694 (folDch)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: ABC89510
RhizoBase: RHE_CH00694
UniProt: Q2KCC6
Position
712241..713140
Genome map
AA seq 299 aa AA seqDB search
MATVIDGKNVAASVIQTVKSATAALEKASGVTTGLAVIIVGDDPASHAYVGSKSRMAKEC
GFKSVQHTLPAETTQEELAGLVATLNADPSIHGILVQLPLPKPLDSEPIIQSILPEKDVD
GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL
LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVKADWVKPGATVIDVGINRVPAP
EKGEGKTRLVGDVAFREVSEIASTITPVPGGVGPMTIAMLMANTVIAAHRAAGQTPPQF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacagtaatcgacggcaagaacgtagctgcatcggtcattcagacggtcaagagt
gcgacggcagcgctggaaaaggcgagcggcgtcacgacgggccttgcggtcatcatcgtc
ggcgacgatccggcaagccacgcctatgtcggctccaagagccggatggccaaggaatgc
ggtttcaaatccgtgcagcacacgctgccggccgagacgacgcaggaggaactggcaggc
ctcgtcgccacgctcaacgccgatccgtcgatccacggcatcctggtgcaattgcccttg
ccaaagccgctcgacagcgagccgatcatccagtcgatcctgccggaaaaggatgtcgac
ggcctgagcgtcgtcaatgctggcaagctcgccaccggcgacctgaagaccggtctggtc
tcctgcacgccggccggcgccatggtcttcgtccgccgcacccatggcgaggatctctcc
ggcctcaacgccgtcgtcatcggccgttccaatctgttcggcaagccgatggcgcaattg
cttctcaacgccaatgcgacggtgacgatcgcgcactccagaaccaagaatctagccgaa
gtctgccgcaacgccgatattctggtcgccgccgtcggccggccggagatggtcaaggcc
gattgggtcaagcccggcgcgaccgtgatcgacgtcggcatcaatcgggtgccggctcct
gagaagggcgagggcaagacccggctggtcggcgacgtcgccttccgggaggtctccgag
attgccagcaccatcacgccggtgcccggcggcgtcgggccgatgaccatcgccatgctg
atggccaacaccgtcatcgccgctcatcgcgctgcagggcaaacgccgccgcagttctga

DBGET integrated database retrieval system