KEGG   Rhizobium etli CFN 42: RHE_CH00695Help
Entry
RHE_CH00695       CDS       T00317                                 

Gene name
aglR
Definition
(GenBank) transcriptional regulator protein, LacI family
  KO
K02529  LacI family transcriptional regulator
Organism
ret  Rhizobium etli CFN 42
Brite
Transcription factors [BR:ret03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    RHE_CH00695 (aglR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_23 HTH_31 HTH_24 HTH_IclR HTH_Crp_2 HTH_5
Motif
Other DBs
NCBI-ProteinID: ABC89511
RhizoBase: RHE_CH00695
UniProt: Q2KCC5
Position
complement(713141..714169)
Genome map
AA seq 342 aa AA seqDB search
MNLKQLSELLGLSQTTVSRALNGYPEVNEATRERVLQAVKETGYRPNKAAQRLATGKAGS
IGLVMPTAPGHQSDVHFGEFLAGLGEEAVRHDFHFVIMPSDPDDEVAALRRLAISGNVDA
LFIAYMRGHDPRLAMLKSLSMPYVVHGRSFGAELDYPYLDIDNEGAFYDATRLLLQLGHT
RFALMNGPMHLDFAIRRRNGVISALAERGLTLEEDCMSHALMTDEQGLLAMERFLQLPER
PTAILCSSTVMALGAIRAVNQAGLRLGEDVSLIAHDDVLPLLKPENFSVPLTTTRSSLRA
AGVRIAQRLIGTVKQAGPFPEQELWKTELIVRASTGPAPQQS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctcaaacagctatcggaattgcttgggctttcgcagacgacggtaagccgggcg
ctcaacggctatcccgaggtcaacgaagcgacccgggagcgcgtgcttcaagccgtcaag
gagaccgggtaccggccgaacaaggctgcccagcggcttgccaccggcaaggcaggctcg
atcggcctcgtcatgccgacggcgcccggccaccagtccgacgtgcatttcggcgaattt
ctggccgggctcggcgaggaagccgtgcgccacgatttccatttcgtcatcatgccttcc
gatccggatgacgaggtggcggcgctccggcggcttgcgatcagcggcaatgtcgatgcg
ctgttcattgcctatatgcgcggtcacgacccgcggctcgccatgctgaagtcactctcc
atgccctatgtcgtgcacggccgctccttcggcgcggagctggactatccctatctcgac
atcgacaatgaaggggccttctacgacgcgacgcgactcttgctgcagctcggccacacg
cgctttgccttgatgaatgggccgatgcatctcgatttcgccatccgcagaaggaacggc
gtcatctcagcgcttgccgaacgcggcctcacgctcgaggaggattgcatgagccacgcg
ctgatgacagacgaacagggcttgctggcgatggaacggttccttcaactgccggaacgg
ccgacggcgatcctctgctccagcacggtgatggcgctcggggcgatccgcgcggtgaac
caggcgggattgcggctcggcgaggatgtctcgctgatcgcccatgacgacgtgctgccg
ctcttgaagcccgaaaacttctcggtgccgctgacgacgacacgctcctcgctgcgggcg
gccggcgtgcgcatcgcccagcggctgatcggcacggtgaagcaggccggccccttcccc
gaacaggagctctggaaaaccgagctgatcgtcagggcctcgacaggtcctgccccgcag
caatcataa

DBGET integrated database retrieval system