KEGG   Rhizobium etli CFN 42: RHE_CH00699Help
Entry
RHE_CH00699       CDS       T00317                                 

Gene name
aglA
Definition
(GenBank) alpha-glucosidase protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00052  Galactose metabolism
ret00500  Starch and sucrose metabolism
ret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RHE_CH00699 (aglA)
   00500 Starch and sucrose metabolism
    RHE_CH00699 (aglA)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     RHE_CH00699 (aglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Alpha-amylase_C GHL5 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: ABC89515
RhizoBase: RHE_CH00699
UniProt: Q2KCC1
Position
718226..719878
Genome map
AA seq 550 aa AA seqDB search
MNVASQSILTADKDWWRGAVIYQIYPRSYQDSNGDGIGDLKGITARLPHVASLGVDAIWI
SPFFTSPMRDFGYDVSDYENVDSIFGTLVDFDTMIAEAHRLGIRVMIDLVISHSSDQHPW
FVQSRSSKTNAKADWYVWADAKPDGSPPNNWLSIFGGSAWAWDPTRMQYYLHNFLTSQPD
MNLHNPEVQDRLLDVVRFWLNRGVDGFRLDTINFYFHDPLLRDNPALAPERRNASTAPAV
NPYNFQEHIYDKNRPENLAFLKRFRAVLEEFPAIAAVGEVGDSQRGLEIVGEYTSGNDKM
HMCYAFEFLAPDPLTPERVEEVMEDFEAAAPDGWACWAFSNHDVMRHVSRWGGLVADHDA
FAKLYASLLMTLRGSVCLYQGEELALTEADLAYQDLQDPYGIQFWPEFKGRDGCRTPMVW
DSHVAQGGFSTVKPWLPVPVEHILRAVNVQQGDETSVLEHYRRFIAFRKLHPAFAKGEIE
FEETEGDTLVFTREYSDEKLLCIFNMSPAETSVTLPAGEWQALTGHGFTSNNYGDKIDIP
AWGAYFARLA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggcttcccaatcgatcttgaccgccgacaaggactggtggcgcggcgcggtg
atctatcagatctatccgcgctcctaccaggattcgaacggcgacggcatcggcgacctg
aagggcatcaccgcccgcctgccgcatgtggcaagcctcggcgtcgatgcgatctggatc
tcacccttcttcacctcgccaatgcgcgatttcggttacgacgtttccgattacgagaat
gtcgattcgatcttcggcaccttggtggatttcgataccatgattgcggaggcccatcgc
ctcggcatccgtgtgatgatcgacctcgtcatctcccacagctcggaccagcacccctgg
ttcgtccagagccgttccagcaagaccaatgccaaggccgattggtatgtctgggccgac
gccaaacccgatggctcgccgccgaacaactggctgtcgatcttcggcggctccgcatgg
gcgtgggatccgacgcgcatgcaatattacctgcacaattttctgacctcgcagccggat
atgaacctgcataacccggaagtgcaggaccgcctgcttgatgtcgtgcgcttctggctc
aatcgcggggtcgacggcttccgcctcgacaccatcaatttctatttccacgacccgctc
ttgcgcgacaatcccgcactcgctcccgagcgccgcaacgcctcgacggctccggcggtc
aatccctataatttccaggagcatatctacgacaagaaccggccggagaaccttgccttc
ctgaagcgcttccgcgccgtgctcgaagagttcccggcaatcgccgccgtcggcgaggtg
ggggacagccagcgcggcctggaaatcgtcggcgaatatacctccggcaatgacaagatg
catatgtgttacgccttcgagttcctggcgcccgatccgttgacgccggagcgcgtcgag
gaggtgatggaggatttcgaagcggccgctcccgacggctgggcctgctgggccttctcc
aatcacgacgtcatgcgtcacgtcagccgctggggcggactggtcgccgatcatgacgcc
ttcgccaagctctatgcttcgctgctgatgacgctgcgcggttccgtctgcctttaccag
ggtgaggaactggctttgacggaggccgatctcgcctatcaggatctgcaggacccttac
ggcattcagttctggccggagttcaagggccgtgacggctgccgcacgccgatggtctgg
gacagccacgtcgcccagggtggcttttccacggtcaagccgtggctgccggtgccggtc
gaacatattctgcgcgccgtcaacgtccagcagggcgacgagacttccgtgctcgagcac
tatcgacgcttcatcgccttccgcaagctgcacccggcctttgccaagggcgagatcgaa
ttcgaggagactgagggcgataccctggtctttacccgagaatatagcgacgagaagctg
ctctgcattttcaacatgagcccggccgaaaccagcgtcactctgcctgcgggagaatgg
caagcattgacgggccatggatttaccagcaacaactatggcgacaagatcgatattccg
gcctggggggcgtatttcgcccgtctcgcctaa

DBGET integrated database retrieval system