KEGG   Rhizobium etli CFN 42: RHE_CH00702Help
Entry
RHE_CH00702       CDS       T00317                                 

Gene name
edd
Definition
(GenBank) phosphogluconate dehydratase protein
  KO
K01690  phosphogluconate dehydratase [EC:4.2.1.12]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00030  Pentose phosphate pathway
ret01100  Metabolic pathways
ret01120  Microbial metabolism in diverse environments
ret01200  Carbon metabolism
Module
ret_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RHE_CH00702 (edd)
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.12  phosphogluconate dehydratase
     RHE_CH00702 (edd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ABC89518
RhizoBase: RHE_CH00702
UniProt: Q2KCB8
Position
complement(721601..723421)
Genome map
AA seq 606 aa AA seqDB search
MSAHARISAITDRIVERSKPTRERYLERLRAAASKGVQRSVLGCANLAHGFAICSPAEKD
ALAGDRVPNLGIITAYNDMLSAHQPFETYPSIIREAAAEAGGVAQVAGGVPAMCDGVTQG
QPGMELSLFSRDLIAMAAGVGLSHNMFDAALFLGVCDKIVPGLVIAALSFGHLPSIFVPA
GPMTTGLPNDEKSRVRQLFAEGKVGRAELLEAESKSYHGPGTCTFYGTANSNQMLMEIMG
FHMPGSSFINPGTPLREALTREAAKRALAITALGNEFTPAGEMIDERSVVNGVVGLHATG
GSTNHTLHLVAMARAAGIQLTWQDIAELSEIVPLLARVYPNGLADVNHFQAAGGMGFLIK
ELLKHGLVHDDVRTVFGQGLAAYTVDARLGENRTVLREPSPDKSHDPKVLSNIETPFQAN
GGLKMLRGNLGKAVIKISAVKPERHIIEAPAIVFHSQQELQDAFKEGKLNRDFVAVVRFQ
GPKANGMPELHKLTPPLGVLQDRGFRVALLTDGRMSGASGKVPAAIHVTPEAVDGGPIAR
IKNGDIIRLDAIKGTLEVLVDAADMAEREPVTVDLSDNEFGMGRELFAPFRRAVGASDQG
ASVLFH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcatgcacgcatttctgcgatcacggatcgcatcgtcgaacgctcgaagccg
acccgcgagcgctacttggaacggctgcgcgccgcggcttccaagggcgtgcagcgttcg
gtgctcggctgcgccaacctcgcccacggcttcgccatctgttcccccgccgaaaaggac
gcgctcgccggcgaccgcgttcccaatctgggcatcatcaccgcctataacgacatgctc
tcggcccaccagccgttcgagacctatccgtcgatcatccgtgaggcggccgccgaggca
ggcggtgtcgcccaggtggccggcggcgtgcccgccatgtgcgacggcgtcacccagggg
cagccgggcatggagctctcgctcttctcgcgtgacctgatcgccatggccgcaggcgtc
ggcctgtcgcacaatatgttcgatgccgctctcttcctcggcgtctgcgacaagatcgtc
ccgggcctcgtcatcgccgcactttccttcggacatcttccgtcgatcttcgttcccgcc
gggccgatgacgacaggcctgccgaacgacgagaagtcgcgcgtgcgccagctgttcgcc
gaaggcaaggtcgggcgcgccgagctcctggaggcagaatcgaaatcctatcacggcccc
ggcacctgcaccttctacggcacggccaactccaaccagatgctgatggagatcatggga
ttccacatgccgggctcctccttcatcaatcccggcacgccgttgcgcgaagcgctgacg
cgcgaagccgccaagcgggcgctcgcgatcaccgcgctcggcaacgaattcacgccggcc
ggcgagatgatcgacgagcgctcggtcgtcaacggcgtcgtcggcctgcatgcgaccggc
ggttcgaccaaccacacgctgcacctcgtcgccatggcgcgggcagccggcattcagctc
acctggcaggacattgccgagctttcggaaatcgtgccgctgcttgcgcgcgtctatccg
aacggtcttgccgacgtaaaccatttccaggcggcgggcggcatgggcttcctcatcaag
gaactcctgaagcacggcctggtgcatgacgacgttcgcaccgtcttcggccaaggcctt
gcagcctacacggtcgacgcccggctcggcgaaaaccgcacggtgctgcgtgaaccgtcg
ccggataagagccacgatccgaaggtgctttccaacatcgagacgcctttccaggcgaat
ggcgggctgaaaatgctgcgcggcaatctcggcaaggcggtcatcaagatctccgccgtc
aaaccggagcgccacatcatcgaggcgccggcaatcgtcttccacagccagcaggaactg
caggacgctttcaaggaaggcaagctcaaccgcgattttgtcgccgtcgtgcggttccag
ggcccgaaggccaacggcatgccggagttgcacaagctgacgccgccgctcggcgtgctg
caggatcgcggcttccgtgtggcgctcctgaccgacgggcgcatgtccggcgcatccggc
aaagtgccggcggcgatccacgtcacccccgaagccgtcgatggcggcccgatcgcccgc
atcaaaaacggcgacatcattcgcctggacgcgatcaagggcacgctcgaagtgctcgtc
gatgccgccgacatggccgagcgcgagccggtgaccgtcgatctctccgacaatgagttc
ggcatgggccgcgagctcttcgcgccgttccgccgcgccgtcggcgcttcggaccagggg
gcgagcgttcttttccactga

DBGET integrated database retrieval system