KEGG   Rhizobium etli CFN 42: RHE_CH00703Help
Entry
RHE_CH00703       CDS       T00317                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase protein
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00030  Pentose phosphate pathway
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
Module
ret_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ret_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ret_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RHE_CH00703 (pgl)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     RHE_CH00703 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: ABC89519
RhizoBase: RHE_CH00703
UniProt: Q2KCB7
Position
complement(723501..724199)
Genome map
AA seq 232 aa AA seqDB search
MASTLHSFASAADLAGSLADTVADRLSAAIAARGAASIAVSGGSTPKAFFQALSTRDIAW
DKVTITLVDERFVPADNTRSNHLLVDANLLQGKAKAARFVPLYQPAASVEEAARLATKKS
AEIGIPFDVVILGMGGDGHTASFFPGGSNLAEALDASTPRGVITMEAEGAGEPRLTFTFS
SLQDAGLLVLHIEGEGKKDVLAKAEGSGDEAEMPIRAVLRRATSPVEIYWAP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaccctgcattccttcgccagtgccgctgacctcgccggcagcctcgccgac
accgtcgccgataggctttcggcagcaatagccgcccgcggcgccgcctccatcgccgtt
tccggcggctcgacgccaaaggccttcttccaggcgctttcgacgcgcgacatcgcctgg
gacaaggtgacgatcacgctggttgacgaacgcttcgtgccggccgacaatacccgctcg
aaccatctgctggtcgatgccaatctcttgcagggcaaggcaaaggcggcgcggttcgtg
ccgctttaccagccggcagcctcggtcgaggaggccgcaaggctggcaacgaaaaagagc
gccgagatcggcattcccttcgacgtcgtcatcctcggcatgggcggcgacggccacacg
gcctcgttctttcccggcggcagcaatcttgccgaggcgcttgatgcgtcgacgccgcgc
ggcgtcatcaccatggaggcagaaggagccggcgagccgcgcctgactttcaccttctcc
agtcttcaggatgccggactgctggttctccatatcgagggcgaaggcaaaaaagacgtt
ctcgccaaggcggaaggcagcggtgacgaggcagaaatgcccatccgcgccgttctgcgc
cgggccacttccccggtcgagatctactgggctccctga

DBGET integrated database retrieval system