KEGG   Rhizobium etli CFN 42: RHE_CH00705Help
Entry
RHE_CH00705       CDS       T00317                                 

Gene name
ordL
Definition
(GenBank) oxidoreductase protein
  KO
K09471  gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00330  Arginine and proline metabolism
ret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    RHE_CH00705 (ordL)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     RHE_CH00705 (ordL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox_3 NAD_binding_8 FAD_oxidored GIDA HI0933_like Pyr_redox FAD_binding_2 Lycopene_cycl AlaDh_PNT_C Trp_halogenase UDPG_MGDP_dh_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABC89521
RhizoBase: RHE_CH00705
UniProt: Q2KCB5
Position
complement(725820..727100)
Genome map
AA seq 426 aa AA seqDB search
MWRSPIAPGLSWYQASVGERPTYAALDGSRTCDVVIVGGGYTGLQAAYNLAKSGVSVVLI
EAWRFGDGASGRNGGQLGTGQRWWPEELEEKIGYERSKALFDVAEAAKRHLLDFAREHQI
EIDYVPGQLNVAHKASYERDYRQNAEIAAERYGYPHLSFMDSKETQERLGSKRFHCGVRD
LGTGHIHPLKLLVGLARVASNAGASIFEMTPAKAIHQSGGKVTIETEKGTITADRALIAC
NGHIGNLEPVTASHVMPIRSFIGATVPLGGYPDVLPGGEAVADSRFVVRYFRKFEGRLLF
GGREAYTADNPRDISQHIRRQIREIYPDLKDIEITHAWGGSVGITMPRQLFVREVMPGVT
SIGGYSGHGVMLSNYCGKLYAETVLGKSGDLDLFKSLEIPAFPGGARMRAPLLFLALSWF
ALRDKF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggagcccgattgcgcccgggctatcctggtatcaggcaagtgtcggggagcgg
ccgacctacgccgctctcgacggttcgaggacatgcgacgtcgtcattgtcggcggcggc
tataccggcctgcaggccgcctacaacctcgccaagtcaggcgtttcggtggtgctgatc
gaggcctggcgattcggagacggagcgtccggacgcaatggcggccagctcggcaccggc
cagcgatggtggccggaagaacttgaggaaaagatcggctacgaacgctcgaaagccctg
ttcgatgttgccgaggcggccaagcgccatcttctcgatttcgcccgggaacatcagatc
gagatcgattatgtgcccggtcagctcaacgtcgcgcataaggcaagctacgaacgcgac
tatcgtcagaatgccgaaatcgccgctgagcgctacggctatccgcatttgagcttcatg
gacagcaaggaaacgcaggagcggctcggctcgaagcgtttccactgcggcgttcgagat
ctcggcaccggccatattcatccgctgaagctgctcgtcgggctggcgcgggtggcctcc
aacgccggcgcttccatcttcgagatgaccccggcaaaggcgatccaccaaagcggcggc
aaggtgacgattgaaaccgaaaagggcacgatcaccgccgaccgggcactgatcgcctgc
aacggccatatcggcaatctggagccggtgacggcaagccatgtcatgccgatccgctcc
ttcatcggcgccaccgttccgctcggcggctatcccgatgtgctgccgggcggcgaggcc
gtcgccgattcgcgcttcgtcgtgcgctatttccgtaaattcgaaggccgtctgctattc
ggcggacgcgaggcctatacggccgacaatccgcgagacatttcgcagcatatccgccgg
cagatcagagaaatctatcccgacctgaaagacatcgagatcacccatgcctggggcggc
agcgtcggcatcaccatgccgcgccagcttttcgtgcgcgaggtgatgcctggcgtcact
tcgatcggcggttattccggccatggcgtcatgctgtcaaactactgtggcaagctctat
gcggaaacggtgcttggcaaatccggcgatctcgatctgttcaaatcgctcgaaattcct
gcctttcccggcggggcccggatgcgggcgccgctgcttttcctagccttgtcgtggttt
gcgcttcgcgacaagttttag

DBGET integrated database retrieval system