KEGG   Rhizobium etli CFN 42: RHE_CH00707Help
Entry
RHE_CH00707       CDS       T00317                                 

Definition
(GenBank) putative oxidoreductase protein
  KO
K07007  uncharacterized protein
Organism
ret  Rhizobium etli CFN 42
Brite
KEGG Orthology (KO) [BR:ret00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RHE_CH00707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HI0933_like Pyr_redox_3 FAD_binding_2 DAO GIDA
Motif
Other DBs
NCBI-ProteinID: ABC89523
RhizoBase: RHE_CH00707
UniProt: Q2KCB3
Position
728734..729867
Genome map
AA seq 377 aa AA seqDB search
MMAAIRAGKRGRSVVVIDHAKAPGEKIRISGGGRCNFTNIHAEPKSFLSANPHFCKSALA
RFTPADFIAMVDRHGIAWHEKTLGQLFCDDSAKDIIRMLLDEMRAVGAGLHLGTEISGVE
RSETGFHVSTGEGFYEASSLIVATGGKSIPKMGATGFAYRLAEQFGLAVLETRPGLVPLT
LDPGLLASIAPLAGISAPAEIRHGRTAFREALLFTHRGLSGPAILQISSYWREGNEIVVV
VEPDIDISAHLKTAKQLNGRQSAQTALGEILPKRLAQFLVEREKIAGNMADLPDKALQRL
AAGAQNWIIKPSGSEGYRTAEVTLGGIDTAALDSRSMETKTVPGLYFVGECVDVTGWLGG
YNFQWAWASGFAAGECA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccattcgcgcgggcaaacgcggccgctcggtcgtggtcatcgaccatgcg
aaggcgcctggcgagaagatccgcatatcgggcggcggtcgctgcaatttcaccaatatc
catgccgaaccgaagagtttcctgtctgccaatccgcatttctgcaagtcggcgctcgcc
cgtttcacgcccgccgatttcatcgccatggtcgaccggcacggcattgcctggcatgaa
aagacgctcggccagcttttctgcgacgatagcgccaaggacatcatccgcatgctgctg
gacgagatgcgcgcggtcggcgcgggcctgcatctcggcaccgaaatatcaggcgtcgaa
aggagcgagacaggcttccacgtctccacgggggagggcttctatgaggcatcctcactg
atcgttgcaaccggcggcaaatcgatcccgaagatgggcgccaccggctttgcctaccgc
cttgccgagcagttcggcctggccgtgctcgaaacccgcccgggtctcgtgccgctgacg
ctcgatcccggcctgctcgcaagcattgcgccgctggccggcatttcggcccccgccgaa
atccgccatggccgcaccgctttccgcgaagcgctgctgttcacccatcggggcttaagc
ggccccgccatcctgcagatttcctcctactggcgggaggggaatgaaatcgtcgtcgtg
gttgaaccggatatcgacatatcagcgcatttgaagacggcaaagcagctgaatggccgc
cagtcggcccagacggctctcggcgagatcctgccgaagcggctggcgcagtttctcgtc
gagcgcgaaaagatcgccggcaatatggccgatctgcccgacaaggcgctgcagcggctg
gccgccggcgcccagaactggatcatcaaaccgtccggttcggaaggctaccgcactgcc
gaggtgacgctcggcggcatcgacacggcggcgctcgattcccgcagcatggaaacaaag
accgttcccggtctttatttcgtcggggaatgcgtcgacgtcaccggctggctcggcggc
tataatttccaatgggcctgggcttccggctttgccgccggcgaatgcgcatag

DBGET integrated database retrieval system