KEGG   Rhizobium etli CFN 42: RHE_CH00709Help
Entry
RHE_CH00709       CDS       T00317                                 

Gene name
mcpZch2
Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02020  Two-component system
ret02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHE_CH00709 (mcpZch2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RHE_CH00709 (mcpZch2)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    RHE_CH00709 (mcpZch2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal Cache_3-Cache_2 sCache_3_3 HAMP sCache_3_2
Motif
Other DBs
NCBI-ProteinID: ABC89525
RhizoBase: RHE_CH00709
UniProt: Q2KCB1
Position
733203..735050
Genome map
AA seq 615 aa AA seqDB search
MPRLFSASIVRQIVAITLFLLAISTAAIVGVTYYNLSRHVMDGAVSDARDAARAMAVLYG
AADQSAKVEVKDNQLSAVTEEAIPALADHSLVDRTAQSISGVATIFQKQGSDYVRISTNV
KKENGDRAVGTKLAAEHPAQSVLARGEAYFGPAELFGRKFMTGYFPIKNASNANVGILFI
GIPMEFYYQRMNELLILVLGIGAVVMLLVGVLAFCTIRLSVKPLQALTASVHSISSGDLD
GAIPCLEKKNEFGEIGRALSLFRDSARARRDLETEAAEQRALSDAERARNDADKRSLDSQ
IDFAVNQLAAGLGRLSQGDVSQTIGTPFVGRLEQLRVDFNASLLRLQDTLSGIRDSASTI
QRNSGAVSASADELSKRTEAQAANLEETAAAVEEITVTVRSSAERAREANNVVAATKKTA
DNSGTVVGDAVAAMQRIEGASQRIEHIIEVIDDIAFQTNLLALNAGIEAARAGEAGKGFA
VVAQEVRELAQRSADAAREIKSLIETSSREVTAGSELVQRTGSVLASISQEIIAISGHVE
TIATASRDQSAALQEVNGSVNAMDQMTQKNASMVAETTQASRLLAGEADTLMALIERFRL
GAEPAVAHLGARKVA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccttttctctgcatccatcgtccgccagatcgtcgcgatcacgctgtttctg
ctggcgatcagcacagcggctattgtcggcgtgacctattacaatctgagccgccatgtg
atggatggtgccgtctccgacgctcgggacgccgcccgcgccatggctgtcctctacggc
gcagccgatcagtctgcgaaggtcgaagtcaaggacaaccagctttccgccgtcaccgaa
gaggccattccggcccttgccgatcattcgctggtcgaccgcacggcgcagtcgatttcc
ggcgttgcgaccatcttccagaagcagggcagcgactacgtccgcatatccaccaacgtc
aagaaggaaaacggcgatcgcgccgtcggcaccaagcttgcagccgagcacccggcccag
tcggttcttgcccggggcgaggcctattttggcccggccgagctgttcggccgcaagttc
atgaccggttatttcccgatcaagaacgcatcgaacgccaatgtcggcattctcttcatc
ggcattccgatggagttctattatcagcgcatgaacgaattgctgatcctggttctcggc
attggcgccgtcgtcatgctgctcgtcggcgttctcgccttctgtacgatccgcctatcg
gtaaagcctttgcaggcgctgaccgcaagcgtccattcgatctcttcgggcgatctcgat
ggggcgatcccctgtctcgagaagaagaatgagttcggtgagatcggccgcgccctctcg
ctcttccgcgacagcgctcgcgcccggcgcgacctggaaaccgaggctgccgaacagcgg
gccctcagcgacgccgagcgcgcccgcaacgatgccgacaagcgctcgctcgacagccag
atcgacttcgccgtcaaccagcttgccgccggccttgggcgcctgtcccagggtgatgtc
tcgcaaacgatcggcacacccttcgtcggccgactggagcagctgcgcgtcgatttcaac
gcatcgctgctgcggctccaggatacgctctccggcatccgcgacagcgcctcgacgatc
cagcgcaacagcggcgccgtgtccgcctctgccgatgagctttccaagcgaaccgaggcg
caggcggcaaatctcgaggaaaccgccgctgcggtcgaagagatcaccgtcacggttcgt
tcttccgccgagcgcgcccgtgaagccaacaatgtcgtcgccgcgaccaagaagacggcc
gacaattccgggaccgtcgtcggcgatgccgtcgctgccatgcagcgcatcgaaggggcc
tcgcagcggatcgaacacatcatcgaggtgatcgacgatatcgccttccagaccaatctt
ctggcgctcaacgccggtatcgaggcggcacgggcgggcgaggccggcaagggctttgcc
gtcgtcgcccaggaggtccgcgagcttgcccagcgttcggccgatgcggcgcgcgagatc
aagtcgctgatcgaaacatccagccgggaagtgacggctggctccgagctggtccagagg
accggcagcgtacttgcctccatcagccaggaaatcattgcgatcagcggccatgtcgaa
accatcgccaccgccagccgcgaccagtcggcggcgctgcaggaggtcaacggttcggta
aacgccatggaccagatgacccagaagaacgcctcgatggttgccgagacgacgcaggca
agccgcctgctcgccggcgaagccgacacgttgatggcgctcatcgagcgtttccgcctc
ggcgcagaaccggcggtcgctcacctcggcgcaaggaaagtcgcctga

DBGET integrated database retrieval system