KEGG   Rhizobium etli CFN 42: RHE_CH00716Help
Entry
RHE_CH00716       CDS       T00317                                 

Gene name
potH
Definition
(GenBank) spermidine/putrescine ABC transporter, permease component I protein
  KO
K11075  putrescine transport system permease protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02010  ABC transporters
Module
ret_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RHE_CH00716 (potH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ret02000]
    RHE_CH00716 (potH)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    RHE_CH00716 (potH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABC89532
RhizoBase: RHE_CH00716
UniProt: Q2KCA4
Position
741931..742842
Genome map
AA seq 303 aa AA seqDB search
MGTLASRFYNRLVIVIPYAWLLLFFLAPFFIVFRISLSTTAIAIPPYEPVFSFADGWSGF
WSKIATFSFDNYGYLTDDPLYFNAYLSSVIIAAVSTLLMLLIAYPIAYGMAQAPRTIRPT
LLMLVILPFWTSFLIRVYAWIAILKPEGLLNQLLLSLHIIDTPLIILNTPTAVYIGIVYS
YLPFMVLPLYSALEKMDGTLIEAAQDLGCTPVQAFWRVTFPLSIPGVVAGCMLVFIPAVG
EFVIPDLLGGSQTLMIGKTLWNEFNANRDWPVSSAVATILLMILVIPIVFFQNVQAKAEE
REK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgctggcatcacgcttctataaccgcctcgtcattgtcattccctatgcttgg
ctgctgctcttctttctggctccgttcttcatcgttttccgcatctcgctgtcgacgacg
gcgatcgccataccgccctatgagcctgttttctcttttgccgacggctggagcggtttc
tggagcaagatcgcgaccttctccttcgacaattacggctatctcaccgacgatccactc
tacttcaacgcctacctgtcgagcgtcatcatcgcggcggtctcgactttgctgatgttg
ctgatcgcttatccgatcgcctatggcatggcgcaggcgccgcgcacgatccggccgacg
ctgctgatgctcgtcatcctgccgttctggacgagcttcctgatccgcgtctatgcctgg
attgccatcctgaagcccgagggactgctgaaccagctcctcctgtcgctgcatatcatc
gacaccccactgatcattctcaacaccccgacggcggtctatatcggcatcgtctattcc
tatctgcccttcatggtgctgccgctctattcggcgctcgaaaagatggacggcacgctg
atcgaggcagcgcaggatctcggctgcacgccggtccaggccttctggcgcgtcaccttc
ccgctatcgatccccggcgtggttgccggctgcatgctggtcttcatccctgccgttggc
gagttcgtcattcccgatcttctcggcggttcgcagacgctgatgatcggcaagacgctc
tggaacgaattcaacgcgaacagagactggccggtctcctcggcggtcgcaaccatcctg
ctgatgatcctggtgatcccgatcgtcttcttccagaatgtgcaggccaaggccgaagag
cgggagaagtaa

DBGET integrated database retrieval system