KEGG   Rhizobium etli CFN 42: RHE_CH00717Help
Entry
RHE_CH00717       CDS       T00317                                 

Gene name
potI
Definition
(GenBank) spermidine/putrescine ABC transporter, permease component II protein
  KO
K11074  putrescine transport system permease protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02010  ABC transporters
Module
ret_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH00717 (potI)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    RHE_CH00717 (potI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 TrbE
Motif
Other DBs
NCBI-ProteinID: ABC89533
RhizoBase: RHE_CH00717
UniProt: Q2KCA3
Position
742846..743664
Genome map
AA seq 272 aa AA seqDB search
MLRWTRFNIISVVLGFAFLYLPIVLLVVFSFNESKLVTVWGGFSAKWYVSLLSNQALLDA
AWVTIRVGLLSATFATILGTMAALTLVRYTRFRGRMLFSGMVYAPLVMPEVITGLSLLLL
FVAIGFDRGFWTITLAHTTLTMCFVAVVVQSRLLSFDQSIEEAAQDLGAPPVRTFFEITL
PIISPAVFSGWILAFTLSLDDLVIASFTSGPGATTLPMKIYSQVRLGVTPEINAICTILI
AIVAVGVICASIVTKRREVQRERDERAAAAGA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctgagatggacccgtttcaacatcatctccgtcgtgctcggctttgccttcctctat
ctgccgatcgtgctgctggtggttttttccttcaacgaatcgaaactcgtcaccgtctgg
ggcggcttctccgccaaatggtatgtctcgctgctctcgaaccaggccctgctcgatgcc
gcctgggtgacgatccgtgtcggtctgctgtcggccaccttcgcgaccatcctcggcacg
atggcggcgctgacgctggtgcgctatacccgcttccgcggccgcatgctcttttcaggc
atggtctatgcgccgctcgtcatgccggaagtcatcaccggtctgtcgctgctgctgctc
ttcgtggcgatcggcttcgaccgcggcttttggacgattacgctggcgcatacgacgctg
accatgtgcttcgtcgccgtcgtcgtgcaatcacggctcttaagcttcgatcagtcgatc
gaggaagccgcgcaggatctgggcgcgccgccggtgcgcaccttcttcgagatcacgctg
ccgatcatctcgccggcggtgttttcgggctggatcctggctttcacgctttcgctcgac
gacctcgtgattgcaagtttcacctccggccccggcgcaaccacgctgccgatgaagatc
tatagccaggtgcgccttggcgtgacgcccgagatcaatgcgatctgcacgatcctcatc
gccattgtcgcagtcggcgttatctgcgcatcgatcgtcaccaagcggcgcgaagtgcag
cgcgagcgcgacgagcgggcggccgccgccggcgcctga

DBGET integrated database retrieval system