KEGG   Rhizobium etli CFN 42: RHE_CH00718Help
Entry
RHE_CH00718       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved membrane protein
  KO
K07289  AsmA protein
Organism
ret  Rhizobium etli CFN 42
Brite
KEGG Orthology (KO) [BR:ret00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    RHE_CH00718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA AsmA_2
Motif
Other DBs
NCBI-ProteinID: ABC89534
RhizoBase: RHE_CH00718
UniProt: Q2KCA2
Position
complement(743689..745581)
Genome map
AA seq 630 aa AA seqDB search
MSTSRHRRWRRKIGPVSRWLPAFARISTLFLLVALALFVALRVAAPYLITTGFVRSGIED
ALSKWTGYHAEIKGNPVLEFWPTPRITLNQVTIRQPRESGDKLLGSIESLSADFSLIDAL
RGRTSFHEFHLLRPNLALTRDENGLIDWSYTGLLAHAISGVRYENGAEVLDPALDAEIGA
VTVEDGTLAVTDVRSAKTYNFDSVTADIGWPRLSGAISAVVIARINGVDLKVDFASRQPL
LAFAGKSAETRTSLTSNLLTARFQGIASIASLSALSGNIAVSIPDVPAFLTWSGRSLPGV
GTLKSASLESDIMSSGSGLRFNDLSLSLNEASATGVMDLSTTTGRRPKIGGTLAFDQMNL
KPFLDAFALRLAAGEAEGISTGISEPLQLLDVDVRLSARRAEMGRFQLSDVGASMIVTGG
EAKFDIGDSGFEGGEMTAHLEATRRDFDGGGKLQLSIRDADFAGLAERLQLKGPLPLATG
SLDLDLQSPKAIWATGLADVTGKLHFWTREGTIPGIDAGALRTQAVEKPFFPLSAAAGGA
FAFNQLDLQADFANGSAEIHDAHVIGPTQTLALSGVVTYQSNGLALSGSLEATDPAKTAE
LPLLPFFVGGSWPNPVISPVPLFGGTPHAQ
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtctagacatcgcaggtggcgcaggaagatcgggcctgtttcgcgctggctt
ccggccttcgcccgcatctcgacgctgtttctgctggttgcgcttgcactgttcgtggcc
ctcagggtcgcagcgccctatctcatcacgacgggtttcgtgcgctccggcatcgaggac
gcgctgtcgaaatggacgggctatcatgccgagatcaagggtaatccggttctcgaattc
tggccgacgccgcgcatcacgctgaaccaggtcaccatccgccagccgcgcgaaagcggc
gacaagctgctcggcagcattgaaagcttgtcggcggatttcagcctcatcgatgcgctg
agaggccggacgagtttccacgaattccatctgctgcggccgaacctggcgctgacgcgt
gacgagaatggcctgatcgactggagttacaccggcctgcttgcccatgcgatcagcggc
gtgcgctacgaaaacggggcggaggtgctcgatcccgctctcgatgccgagatcggtgcg
gtgaccgtcgaggacggcacgcttgccgtgaccgacgtcaggagcgccaagacttacaat
ttcgacagcgtcacggccgacatcggctggccacggctctcgggcgcgatctcggctgtc
gtgatcgcccgtatcaacggcgttgacctgaaggtggatttcgcctcgcgccagccgctg
ctcgcctttgccggcaagagcgccgagacgcggacatcgctgacgtcaaacctgctgacg
gcccgttttcaggggatcgccagcatcgccagcctttcggcgctttccggcaacatcgcc
gtcagcattcccgatgtgccggcatttctgacatggtcgggcagatcgctccccggtgtc
ggcacgctgaagagcgcctcgctggaatccgacatcatgtcgtcgggcagcgggctgcgt
ttcaacgatctcagcctgtcgctgaacgaggcgagcgccaccggcgtgatggacctttcg
accacgaccggcagacggccgaagatcggcggcacgctcgccttcgaccagatgaacctg
aagccgttcctcgacgcctttgcgctgagattggcggccggcgaggcggagggaatctcc
accggcatcagcgagccgctgcagttgctcgacgtcgacgtcaggctttcggcgcggcgg
gctgagatgggccgcttccaactctccgatgtcggcgccagcatgatcgtcaccggcggc
gaggcgaagttcgatatcggcgacagcggcttcgaaggcggcgaaatgacggcacatctg
gaggcgacgcggcgcgacttcgacggcggcggcaagctgcagctatcgatccgcgatgcc
gacttcgccggccttgccgagcgtctgcagctcaaaggaccgctaccgcttgcgacggga
tcgctcgatctcgacctgcagtcgccgaaagcgatctgggcgaccggtcttgccgacgtc
accggtaagctgcatttctggacgagggaaggcacgatccccggcattgacgccggcgcg
ctcaggacacaggctgtcgaaaagccgttctttccgctgagtgccgcagcaggcggtgcc
ttcgccttcaaccaattggaccttcaagccgatttcgccaacggctccgccgaaatccat
gacgcccatgtcatcgggcctacgcagacgctggcgctttccggcgtggttacctatcag
tcgaacgggctggcgctttccggttcgctggaggcaaccgatccggccaagacggcagag
ctgccgcttctgccgttcttcgtcggcggctcatggccgaacccggtgatctcgccggtt
ccgctttttggcggcacgccccacgcgcaataa

DBGET integrated database retrieval system