KEGG   Rhizobium etli CFN 42: RHE_CH00732Help
Entry
RHE_CH00732       CDS       T00317                                 

Definition
(GenBank) probable exodeoxyribonuclease III protein
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ret00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    RHE_CH00732
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ret03400]
    RHE_CH00732
Enzymes [BR:ret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     RHE_CH00732
DNA repair and recombination proteins [BR:ret03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     RHE_CH00732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-ProteinID: ABC89546
RhizoBase: RHE_CH00732
UniProt: Q2KC90
Position
770109..770381
Genome map
AA seq 90 aa AA seqDB search
MPQTRQAFRRLENLGLTDAVRATTDATRLYSFWDYQAGAWPKNNGIRIDHLLLSPEAADR
MTSAAIEKHVRAWEKPSDHVPVIAYFDFAA
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagacgcggcaggcattccgcaggctcgaaaatctcggcctgaccgatgcggta
cgcgcgacgacggatgcgacgcggctctattccttctgggactatcaggcaggtgcatgg
ccgaagaacaacggcatccgcatcgaccacctgctgctctcaccggaggctgccgaccgg
atgacgtcggcggcgatcgaaaaacatgtacgggcctgggaaaagccgtccgaccacgta
cctgtcatcgcctatttcgattttgcggcctga

DBGET integrated database retrieval system