KEGG   Rhizobium etli CFN 42: RHE_CH00733Help
Entry
RHE_CH00733       CDS       T00317                                 

Gene name
exoR1
Definition
(GenBank) exopolysaccharide production negative regulator protein
  KO
K07126  uncharacterized protein
Organism
ret  Rhizobium etli CFN 42
Brite
KEGG Orthology (KO) [BR:ret00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RHE_CH00733 (exoR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sel1 TPR_2
Motif
Other DBs
NCBI-ProteinID: ABC89547
RhizoBase: RHE_CH00733
UniProt: Q2KC89
Position
complement(770438..771235)
Genome map
AA seq 265 aa AA seqDB search
MVTSEFKLFKFMLMGMGIALAMSGPVRAFDIKSDVSKESGPFDLFKFGFKAYKNGQKEEA
VEAYKYAAEKGHTGSRWALANMYADGDGVAQDDFEAFKIYSEIAQQGVEPGSEDTGFFVN
ALLSLANYYKHGISGSPVKIDLTQARQLYFQVASTFGVPEAQFQLAQMMLAGEGGNASPQ
QAKKWLNQARKSGHPGAMAVFGNILFDEGQTARGLALMTAALDRCKPKDCSWMEALQEQA
FSVSNEADRRTAVSLSHAIASGSDD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgtccgagttcaaattgttcaaattcatgctgatgggcatggggatagcgctg
gcaatgtccggcccggttcgcgctttcgacatcaagagcgacgtcagtaaggaatccggt
cctttcgacctcttcaagttcggcttcaaggcctataagaacggacagaaggaggaggcg
gtcgaagcttacaagtacgccgccgaaaagggccataccggttcgcgctgggcgctcgcc
aatatgtatgccgacggcgacggcgtcgcccaggatgatttcgaagccttcaagatctac
agcgagattgcccagcagggtgtcgaacccggttcggaagacaccggcttcttcgtcaac
gcgcttctgtcgctcgccaattactacaaacacggcatatcaggcagcccggtcaagatt
gatctcacccaggcacgccagctttatttccaggtggcctcaacctttggcgttcccgaa
gcgcagttccagttggcgcagatgatgctggccggcgagggcggcaatgccagcccgcag
caggcgaagaaatggttgaaccaggcgcgcaagagtggccatcccggcgccatggcggtt
ttcggaaatattctctttgacgaaggtcagacggcccgcggtctcgcgctgatgactgcc
gctctcgaccgctgcaagcccaaggactgcagctggatggaagcgcttcaggagcaggcc
ttctcggtttccaacgaggccgaccggcgcacggcggtctcgctctcgcacgccatcgca
agcggctccgacgactga

DBGET integrated database retrieval system