KEGG   Rhizobium etli CFN 42: RHE_CH00738Help
Entry
RHE_CH00738       CDS       T00317                                 

Gene name
dppCch1
Definition
(GenBank) dipeptide ABC transporter, permease protein
  KO
K12370  dipeptide transport system permease protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02010  ABC transporters
Module
ret_M00324  Dipeptide transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH00738 (dppCch1)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00324] [OT]
    RHE_CH00738 (dppCch1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF3169
Motif
Other DBs
NCBI-ProteinID: ABC89552
RhizoBase: RHE_CH00738
UniProt: Q2KC84
Position
775976..776866
Genome map
AA seq 296 aa AA seqDB search
MSTVTVKTGQPSALAEFWHYFSRNKGAVIGLVVFILILVVAVFAPVFAPHAPNEQNRQAL
LAVPAWMEGGSASFPLGTDAVGRDILSRLIYGARFSLFIGVVVVTLSVVCGVLIGLVAGY
FRGRIDTAIMRLMDIILAFPSLLLALVLVAVLGPGLTNAMIAISLVNQPHFVRLTRASVI
SEREKEYVIASRVAGAGTLRLMFKTILPNCLGPLIVQATLAFSAAILDAAALGFLGMGAQ
PPTPEWGTMLAESREFISRAWWVVTFPGLAILITVLAINLMGDGLRDALDPKLKRS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggtcaccgtcaaaaccggccagccatccgctcttgcggaattctggcattac
ttctcccgcaacaagggcgccgtcatcggcctcgtggtcttcatcctcattctggtcgtt
gccgtcttcgcgccggtctttgcgccgcatgcaccgaacgagcagaaccgccaggcgctg
ctcgccgtgccggcgtggatggagggtggcagcgcctcattcccgctcggaaccgatgcc
gtcggccgcgatatcctctcgcgcctgatctacggcgcgcgcttctcgctattcatcggc
gtcgtcgtcgtcacgctttcggtcgtctgcggcgttttgatcggcctcgtcgccggatat
ttccgcggcaggatcgatacggcgatcatgcgcctgatggatatcatcctggccttcccg
tcgctgctgctcgctctcgtactggtggccgtgctcgggcccggcctgaccaacgcgatg
attgcgatttcgctggtcaaccagccgcatttcgtccgcctgacgcgcgcctcggtcatt
tcggaacgtgagaaggaatatgtgatcgcctcgcgtgtcgccggtgccggcacgctgcgc
ctgatgttcaagacgatcctgccgaactgtcttgggccgctgatcgtccaggcgacgctc
gccttctcggcggcgatcctcgatgctgcagccctcggctttctcggcatgggcgcgcag
ccgccgacacccgaatggggcacgatgctcgccgaatcccgcgaattcatctcgcgcgcc
tggtgggtcgtaacattcccgggtcttgccatcctcatcaccgttctcgccatcaacctg
atgggcgacggcctgcgcgatgcgcttgaccccaagctgaagaggtcgtga

DBGET integrated database retrieval system