KEGG   Rhizobium etli CFN 42: RHE_CH00805Help
Entry
RHE_CH00805       CDS       T00317                                 

Definition
(GenBank) probable phosphate transport permease protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ret  Rhizobium etli CFN 42
Brite
KEGG Orthology (KO) [BR:ret00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RHE_CH00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABC89616
RhizoBase: RHE_CH00805
UniProt: Q2KC20
Position
complement(842938..844437)
Genome map
AA seq 499 aa AA seqDB search
MPPRPAVLTKRTLDKDLDKITHVEDVAKHVLRRLVAPGLGLIFVGLTMLFAGVYVFDRPG
AMLVVAAAALAGYMAMNIGANDVTNNVGAAVGARAMTMGQALVIAAIFEVLGATIAGGEV
VKTISSNIVDAVQVPQVALGWIMMAALMAAALWINLATWMNAPVSTTHAIVGAVIGAGIS
AVGTEPVNWRVMLEITSSWITSPLIGGLIAAGLLYLVKTLIIYRDDKIAAARLWVPVLVA
AMAGAFMAYMVLQLSPPGRFPPFTVILIGIGIGLVSWLAARPLVLAQAQGLENRNSSLRV
LFRLPLIGSAALLSFAHGANDVSNAVGPLSAIVHSAGIGSDGGVGHPPLWVMLIGALGIS
VGLLLFGPRLIRLVGEEITKLNPMRAYCVALSTAFTVIVASWLGLPVSTTHIAVGAVFGV
GFFREWYTRRSKRRIAYIRRKADSWELDEPEEPNIHERRRRYLVRRSHFMTIIAAWIITV
PVSGALAAMIYWVMFALFV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccaccacgccctgccgtcctcacgaaacgcacgctcgacaaggacctcgacaagatc
actcatgtcgaggacgtggccaagcatgtgttgcgacgactggtggcgcccgggcttggg
ctgatcttcgtcggcctgaccatgctctttgccggtgtctatgtgttcgaccgcccagga
gccatgctcgtcgtggcggcggcggcccttgccggctacatggcgatgaatatcggcgcc
aatgacgtcaccaacaatgtcggcgccgccgtcggtgcgcgcgccatgacgatgggccag
gcgctcgtcatcgccgcgattttcgaagtcctcggcgccacgatcgccggcggcgaggtc
gtcaagacgatttcctccaacatcgtcgacgccgtccaggtgccgcaggttgcgctcggc
tggatcatgatggcggcgctgatggcggcggccctctggatcaatctcgccacctggatg
aacgcgccggtttcgaccacccatgcgatcgtgggtgcagtgatcggcgccggcatctcg
gccgtcgggacggagccggtgaactggcgggtcatgctggagatcacctcgagctggatc
acttcgccgttgatcggtggattgattgccgccggcctgctttatctcgtcaagacgctc
atcatctatcgcgacgacaagatcgcggcggcacgactctgggtgccggtgctggtcgcg
gcgatggccggcgcctttatggcctatatggtgctgcagctctcgcctccgggccggttc
ccgcccttcaccgtcattctgatcggtatcgggatcgggctggtcagctggcttgcggct
cggccactcgttctcgcccaggcgcagggtctcgaaaaccgcaacagctccctgcgggtg
ttgttccggctgccgctcatcggctctgcggcgctgctgtccttcgcgcatggcgctaac
gacgtctcgaacgcggtcgggccgctttcggcgatcgtccattcggccggcatcggcagc
gacggcggcgtgggccatccgcccctctgggtaatgctgatcggcgccctcggcatctcc
gtcggcctgctgctcttcgggccgcgcctcatccgtctggtcggcgaggagatcaccaag
ctcaacccgatgcgcgcctactgcgtcgcactgtcgaccgctttcaccgtcatcgtcgcc
tcctggctcggcctgccggtcagcaccacgcatatcgccgtcggcgccgtcttcggcgtc
ggcttcttccgcgaatggtacacccgccgttccaagcgccgcatcgcctatatcaggcgc
aaggccgacagctgggaactggatgaaccggaggagccgaacattcatgaaaggcggcgg
cgctatctcgtgcgtcgctcgcatttcatgacgatcatcgcggcctggatcatcactgta
ccggtttcgggagcgcttgcggcgatgatttattgggttatgttcgcgctctttgtctga

DBGET integrated database retrieval system