KEGG   Rhizobium etli CFN 42: RHE_CH00890Help
Entry
RHE_CH00890       CDS       T00317                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA synthetase, beta subunit protein
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ret00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RHE_CH00890 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ret01007]
    RHE_CH00890 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ret03016]
    RHE_CH00890 (glyS)
Enzymes [BR:ret01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     RHE_CH00890 (glyS)
Amino acid related enzymes [BR:ret01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   RHE_CH00890 (glyS)
Transfer RNA biogenesis [BR:ret03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RHE_CH00890 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: ABC89701
RhizoBase: RHE_CH00890
UniProt: Q2KBT5
Position
complement(931735..933849)
Genome map
AA seq 704 aa AA seqDB search
MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLT
ARSADVREERKGPRTDANEKAIEGFLRGAGLSSISEAQVVNDPKKGDFYVAVISKPGRAT
EEIVAEVMPGIIRDFPWPKSMRWGKASSAPGALRWVRPLQSIVCTFGPEHEETTVIPFEI
DGITASNITYGHRFHAPEAIMVRRFDDYAASLERAKVILDAERRKDIILHDARDIAFANG
LELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRKQGEDTL
SNRFILVSNIEASDGGKEIVHGNGKVVRARLSDALHFWKRDQGNLPDLETLAASAAKFGL
DLQKPLDQRMAKLDALDVTFHAKLGTQGARVARIRALAQKLAAVTGADAALTDRAAVLAK
ADLRTEAVGEFPELQGLMGRKYAALQGENASVAAAIEDHYKPQGPSDRVPEDKVAITLAL
ADKLDTLTGFWAIDEKPTGSKDPFALRRAALGVVRILLERGIRLPLLATTRDGDLLSFFH
DRLKVYLRDQGARHDLIDAVLTPEADDLLMVARRVEALTAFITSEDGKNLLAGTKRATQL
LAAEEKKGTVIADGVSPALFKLDAEKELFAAISSASKDAANAVAGEDFRSAMEALSKLRG
PVDRFFEDVLVNDEDAAIRANRLALLRLIREATGTVADFSKISG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaccttcttctcgaactccgctccgaagagattccggcccgcatgcagcgaaag
gctgccggcgacctgaagaagctcgtcaccgatgcgctcgtagaagccggcctgtcctac
gaaggcgcgcgcgaatattggacgccgcggcggctggcgctcgacattcacggcctgacg
gcgcgctcggccgatgtgcgcgaggagcgcaaggggccgcgcaccgatgccaacgagaag
gcaatcgagggtttcttacgcggcgccggcctgtcgtcgatctccgaggcgcaggtggtc
aacgatccgaagaagggcgatttctacgtcgcggtgatctccaagccaggccgcgcgacg
gaagagatcgtcgccgaggtgatgcccggcatcatccgcgatttcccctggccgaagtcg
atgcgctggggcaaggcttcctccgcgccgggagcgctgcgctgggtgcggccgctgcaa
tcgatcgtctgcaccttcggccccgaacatgaggaaaccaccgtcatccccttcgagatc
gacggcatcaccgcctccaacatcacctacggccaccgcttccatgcgcccgaggcgatc
atggtgcggcgcttcgacgattatgcggcgagcctggaaagggcgaaggtcatcctcgac
gccgagcggcgcaaggacatcatcctgcacgacgcccgcgacatcgcctttgccaatggg
ctcgaactggtggaagacgaaggcctgctggaggaagtttccggcctcgtcgaatggccg
caggtgctgatgggcagcttcgaggaggactacctctccattccctcggagatcatccgg
ctgacgatcaagaccaaccagaagtgcttcgtcacgcgcaaacagggcgaggacacgctg
tcgaaccggttcatcctcgtctccaacattgaggcgagcgacggcggcaaggagatcgtc
cacggcaacggcaaggttgtgcgggcccggctatcggatgcactgcatttctggaagcgc
gaccagggcaacctgccggatctcgagacgctcgcagcatcggcggcaaagtttggcctc
gacctgcagaagccgctcgaccagcgcatggccaagctcgacgcactcgatgtgaccttc
catgccaagctcggcacgcagggcgcgcgcgtcgcccgcatccgggcgctggcacagaaa
ttggctgcggtcaccggcgccgatgcggcgctcaccgatcgcgccgccgtgcttgccaag
gccgatctgcgcaccgaagccgtcggcgaatttccagagctgcagggcctgatgggccgc
aaatatgcggcactgcagggcgagaatgcctccgttgccgcagcgatcgaggaccactac
aagccgcaaggcccgtcggaccgggtgccggaagacaaggtggcgatcacgttggcgctt
gccgacaaactggatacgctgaccggcttctgggcgatcgacgaaaagccgaccggctcc
aaggacccttttgcactgcggcgtgcagccctcggcgtcgtcaggatcctgctggagcga
ggaatccgcctgccgctgttggcaacaacaagggatggcgacctgctctccttcttccac
gaccgcctcaaggtctatctgcgcgaccagggcgcccgccacgatctgatcgacgccgtg
ctgacgcctgaagccgacgacctgttgatggtggcacgccgcgtcgaggcgctgacggcc
ttcatcacctcggaggatggcaagaacctgctcgccggcaccaagcgcgcgacgcagctg
ctcgccgccgaggagaagaagggcaccgtcatcgccgacggggtttcgccggcgctcttc
aagctcgacgcggagaaggagctgttcgccgccatatcgagcgcctcgaaggatgcagcg
aatgccgtggctggcgaagatttccgctccgcgatggaagcgctttccaaactacgcggc
ccggtcgaccgcttcttcgaagacgtgctcgtcaacgacgaggacgccgcgatccgcgcc
aaccgcctcgccctgctcagactgatccgcgaagcaacgggaacggtggcggatttctcg
aagatttcgggatga

DBGET integrated database retrieval system