KEGG   Rhizobium etli CFN 42: RHE_CH02353Help
Entry
RHE_CH02353       CDS       T00317                                 

Definition
(GenBank) putative phosphoglycerate mutase protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00010  Glycolysis / Gluconeogenesis
ret00260  Glycine, serine and threonine metabolism
ret00680  Methane metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
ret01230  Biosynthesis of amino acids
Module
ret_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_CH02353
  Energy metabolism
   00680 Methane metabolism
    RHE_CH02353
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH02353
Enzymes [BR:ret01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHE_CH02353
Membrane trafficking [BR:ret04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RHE_CH02353
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHE_CH02353
  Exosomal proteins of melanoma cells
   RHE_CH02353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABC91133
RhizoBase: RHE_CH02353
UniProt: Q2K7Q3
Position
2458717..2459466
Genome map
AA seq 249 aa AA seqDB search
MRLFLVRHGESLGNIDERAYRQFGDHSVPLTQWGYRQALEAGCVITSYLRGLPDDGFQKL
RIWYSPFLRTRQSKDALLEALPEDFVSDVREDYLLREQDFGLFTEIYDQAERKQKFPEEF
EKWARLRSNSGKFYARPPDGESRADVAQRVRLFLQTVMRDGENDDQNIAIVGHGVTNRAV
EMNFLHRPVEWFERSDNPGNADVTLIEGTRSQGYASILLHRAADRLPGEEGELRDAHGAD
VTITPRLGG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctttttctcgttcgccacggcgaatccctcggcaacatcgacgaacgggcctat
cgccagttcggcgatcacagcgtgcccctgacgcaatggggctatcggcaggctttggag
gccggctgcgtgatcacatcctatctgcggggattgccggatgacggatttcagaagctg
cgcatctggtactccccgtttctgagaacacgacagagcaaggatgcgttgctcgaagcc
cttccggaagatttcgtcagcgatgtcagggaagattatctgctgcgcgaacaggatttc
ggcctcttcaccgaaatctatgaccaggccgaaagaaaacagaagttcccggaagaattc
gaaaaatgggcgcggctacgcagcaatagcggcaagttttatgcgcgtccacccgatggc
gaaagccgggcggatgttgcccaacgggttcgcctcttcctccagacggtcatgcgcgac
ggcgagaacgacgaccagaacatcgccattgtcggccacggcgttaccaatcgggcggtc
gaaatgaactttctgcaccgccctgtcgaatggttcgagcgctccgacaatcccggaaat
gccgacgttacgctgatcgagggcacgcgctcgcaaggctatgcgtcaatcctgctgcac
cgtgcggccgaccggctgcctggagaggaaggcgagctgcgcgatgcccatggtgccgac
gtgacgatcaccccgagacttggtggctga

DBGET integrated database retrieval system