KEGG   Rhizobium etli CFN 42: RHE_CH03561Help
Entry
RHE_CH03561       CDS       T00317                                 

Gene name
exoN
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00040  Pentose and glucuronate interconversions
ret00052  Galactose metabolism
ret00500  Starch and sucrose metabolism
ret00520  Amino sugar and nucleotide sugar metabolism
ret01100  Metabolic pathways
ret01130  Biosynthesis of antibiotics
Module
ret_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RHE_CH03561 (exoN)
   00052 Galactose metabolism
    RHE_CH03561 (exoN)
   00500 Starch and sucrose metabolism
    RHE_CH03561 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    RHE_CH03561 (exoN)
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RHE_CH03561 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DNA_mis_repair CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABC92317
RhizoBase: RHE_CH03561
UniProt: Q2K4B9
Position
complement(3751401..3752288)
Genome map
AA seq 295 aa AA seqDB search
MAHHNKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPIIQYVVDEALEAGIEHLVFVT
GRNKHIIEDYFDIHFELEQTLRERAKEAEITLLAEQLPKAGTVSFTRQQEPLGLGHAVWC
AREIVGDEPFALLLPDMIMKGDKGCMKGMIDLYAQSGGNIIAVEECAPDQAHKYGIVGVG
EAIGEGFRITGMVEKPAKGTAPSNFFINGRYILQPEIFRILETQERGAGNEIQLTDGMLK
LLKEQDFAGYHFRGTTYDCGAKDGFILANVAYALERADIRPSVEGGFKELLAGLN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcatcacaataaagttcgtaaggcagtttttccggtggcagggttgggaacgcgt
ttcctgccggcaacgaaggctgttccgaaggaaatgttgaccgttgtcgacaagcctatc
attcaatatgtcgtcgatgaggcgctggaagccggaatcgagcatctggtcttcgtcacc
ggacgcaacaagcacattatcgaagactatttcgacattcatttcgagctggaacagacg
ctgcgcgagcgtgccaaggaggcggaaatcacccttcttgccgagcaactgccgaaggcc
ggcacggtaagcttcacccgtcagcaggagccgctcggcctcggtcacgccgtctggtgc
gcccgcgagatcgtcggcgacgaacctttcgcgctgctgctgcccgatatgatcatgaag
ggcgacaagggctgcatgaaggggatgatcgacctctacgcccagagcggcggcaatatc
atcgccgtcgaggaatgtgcccccgatcaggctcataaatacggcatcgtcggcgtgggc
gaagcgatcggggaaggcttccgcatcaccggcatggtggaaaagcctgccaagggaaca
gcgccctcgaatttcttcatcaacggccgctacatcctgcagccggagatcttcaggatc
ctcgaaacccaggagcgcggcgccggcaacgaaatccagctcaccgacggcatgctgaag
ctgctgaaggaacaggatttcgccggctaccacttccgtggcacgacctacgactgcggc
gccaaggatggcttcatcctggccaacgtcgcctacgccctcgaacgcgccgatatccgt
ccgtcggtcgaaggcggcttcaaggaactgcttgccggcctgaattaa

DBGET integrated database retrieval system