KEGG   Rhizobium etli CFN 42: RHE_CH03568Help
Entry
RHE_CH03568       CDS       T00317                                 

Definition
(GenBank) probable threonine aldolase protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00260  Glycine, serine and threonine metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH03568
Enzymes [BR:ret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RHE_CH03568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABC92324
RhizoBase: RHE_CH03568
UniProt: Q2K4B2
Position
3762846..3763898
Genome map
AA seq 350 aa AA seqDB search
MFFASDNWAGAHRFIAERLLAESAGFAPAYGAGDLDKKVEARFCEIFEREVSVFFVATGT
AANSLALASVQRPGGITFCHSEAHVIEDECGAPEFFSGAARLMAIDGEAGKIDPARLSAK
IAHFPEDALRHGRASAVTITQPTEIGTVYSLPEIGEIAAISRKRNLPLHMDGARFANALI
ALDATPAEMTWKRGVDMLSFGGTKNGCWCAEAIIFFDPERAREMPFIRKRAAQLFSKSRF
IAAQFDAYFENGLWLDLARHSNAMADRLRAGIAASSAGRLAWPTASNEVFAVISRSAART
AEEKGAKFYEWPVPAAASELVSESETLIRLVTSFATTVADVDGFLRCLTA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgcatccgacaattgggccggcgcccacagattcattgctgaacgcctgctg
gcggaatcggctggttttgccccggcctatggagccggcgatctcgataaaaaggtcgag
gcccgcttctgcgagatcttcgaacgggaggtttccgttttcttcgtcgccaccggcacg
gccgccaactccctggcgctggcgagcgtccagcgccccggcgggatcaccttctgccat
tcggaagcccatgtgatcgaagatgaatgcggcgcgccggaattcttctccggcgccgcc
cgcctcatggccatcgacggcgaagccggcaagatcgatccggccaggctttcggcaaag
atcgcccacttccccgaggacgccctccgtcatggccgcgccagcgctgtgaccatcacc
cagccgaccgagatcggcaccgtctattcactgccggagatcggcgagatcgccgccatc
tcgagaaagcgcaatctgccgctccacatggatggcgcccgcttcgccaatgcgctgatc
gcactcgatgccaccccggcggagatgacctggaagcgcggcgtcgacatgctgtccttc
ggcggcaccaagaacggctgctggtgcgccgaggcgatcatcttttttgatccggagcgg
gcacgcgaaatgcccttcattcgcaagcgcgccgcccagctcttctccaagtcgcgtttc
atcgccgcccagttcgatgcctatttcgaaaacggcctctggctcgatctcgcccgccat
tcgaacgccatggctgaccggctgcgcgccggtattgcggccagcagtgccggacgcctc
gcctggccgaccgcttccaatgaggtctttgccgtcatcagcaggagtgctgcaagaacc
gcagaggaaaagggcgcgaaattctacgaatggccggtgcccgcggcagcgtcggaactc
gtttccgaaagcgaaaccctgatccgcctcgttaccagcttcgcgacgacagtggccgac
gtggatggtttcctgaggtgcctgaccgcctga

DBGET integrated database retrieval system