KEGG   Rhizobium etli CFN 42: RHE_CH03621Help
Entry
RHE_CH03621       CDS       T00317                                 

Definition
(GenBank) probable 2-hydroxyacid dehydrogenase protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABC92376
RhizoBase: RHE_CH03621
UniProt: Q2K460
Position
complement(3831856..3832812)
Genome map
AA seq 318 aa AA seqDB search
MSRIAILVPGKIHECVLERLKDRFEIIAVPRGERLALDGETGGRIRGVAVSGAFPGAWMD
QLPNLEVIASFGVGYDGMDVKRAAEKGIVVTNTPDVLNDEVADTTIGLLLNTIRELPRAE
AWLRDGNWRPGTAYPLSRFSLKGRHVGLYGLGRIGLEIAKRLEPFKVKISYHTRSRHADV
SYDYYPTLKGLAEAVDTLIAIVPKTPQTHKTIDADILAALGPDGILVNVGRGWTVDEEAL
GTALASGVLGAAGLDVFYEEPTVPTDLLTAENAVLLPHVASASVPTRNAMADLVADNLIA
WFEKGSALTPVPETPQKS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcgccattctcgttcctgggaagatacacgagtgtgttctcgaaaggctg
aaggatcgttttgagattatcgccgtcccacgcggcgaaaggcttgctctcgacggagaa
accggcggtcgcattcgcggcgtcgcggtttccggcgcctttccaggcgcctggatggac
cagctgcccaacctggaggtgatcgccagtttcggggtcggttatgacggtatggatgta
aagcgtgctgccgaaaagggtattgtcgtcaccaatacacctgatgttctgaacgacgag
gtcgccgacacgacgatcggcctgctcctgaatacgatccgcgaattgccgcgggccgaa
gcctggctgcgcgacggcaactggaggccgggcacggcctatccgctgtcgcgcttctcg
ctcaagggccgccatgtcgggctctacggccttggccgcatcgggctcgaaatcgccaaa
cggctggagccgttcaaggtgaagatcagctaccacacccgatcgcgccatgccgacgta
tcttatgattattacccgacgctgaaggggctggcggaagcggtggatacgctgatcgcc
atcgttccgaaaacgccgcagacacataagaccatcgacgccgatattctggcggccctc
ggcccggatggtattctcgtcaatgtcggccgtggctggacggtggacgaagaggcgctc
ggcacggcgcttgcatccggcgtgctcggggcggccggtctcgacgtcttctacgaagag
ccgacggtgccgaccgatctgcttacggccgaaaatgccgtgctgctgccgcatgtcgct
tcggcatcagtgccgacgcgcaatgccatggcggatcttgtcgccgacaatctcatcgcc
tggttcgaaaaggggtcggcgctgacgccggtgccggagaccccgcagaagagttag

DBGET integrated database retrieval system