KEGG   Rhizobium etli CFN 42: RHE_CH03896Help
Entry
RHE_CH03896       CDS       T00317                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase subunit D, membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00020  Citrate cycle (TCA cycle)
ret00190  Oxidative phosphorylation
ret00650  Butanoate metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
Module
ret_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ret_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHE_CH03896 (sdhD)
   00650 Butanoate metabolism
    RHE_CH03896 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RHE_CH03896 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Pox_F16
Motif
Other DBs
NCBI-ProteinID: ABC92642
RhizoBase: RHE_CH03896
UniProt: Q2K3E4
Position
complement(4130555..4130935)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALS
NPFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIASLCLFSIL
KIAFVG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgcacccccctcggcaaggttcgcgggctcggctccgccaaggaaggcacg
agccatttctggcgtcagcggctgaccgccgtctcgaacattccgttgatcctgttcttc
gtcatcttcatgatcgcctatgccggcgcgccctatgcggatgtcgtccgcgcgctgtcc
aaccctttcgtcgccgtggtcatggggctgatggtgatctcaggcgtcatccacatgaag
ctcggcatgcaggtcatcatcgaggactacgtgcatggcgagttcggcaagatcgctctc
ttgatgctgaacacgttcttcgcgatcgtgatcgccagcctctgtctcttctccattctg
aaaatcgcattcgtaggataa

DBGET integrated database retrieval system