KEGG   Rhizobium etli CFN 42: RHE_CH04018Help
Entry
RHE_CH04018       CDS       T00317                                 

Gene name
phbAch
Definition
(GenBank) acetyl-CoA acetyltransferase (beta-ketothiolase) protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00071  Fatty acid degradation
ret00072  Synthesis and degradation of ketone bodies
ret00280  Valine, leucine and isoleucine degradation
ret00310  Lysine degradation
ret00362  Benzoate degradation
ret00380  Tryptophan metabolism
ret00620  Pyruvate metabolism
ret00630  Glyoxylate and dicarboxylate metabolism
ret00640  Propanoate metabolism
ret00650  Butanoate metabolism
ret00900  Terpenoid backbone biosynthesis
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
ret01212  Fatty acid metabolism
ret02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHE_CH04018 (phbAch)
   00630 Glyoxylate and dicarboxylate metabolism
    RHE_CH04018 (phbAch)
   00640 Propanoate metabolism
    RHE_CH04018 (phbAch)
   00650 Butanoate metabolism
    RHE_CH04018 (phbAch)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHE_CH04018 (phbAch)
   00072 Synthesis and degradation of ketone bodies
    RHE_CH04018 (phbAch)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHE_CH04018 (phbAch)
   00310 Lysine degradation
    RHE_CH04018 (phbAch)
   00380 Tryptophan metabolism
    RHE_CH04018 (phbAch)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHE_CH04018 (phbAch)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHE_CH04018 (phbAch)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHE_CH04018 (phbAch)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ret04147]
    RHE_CH04018 (phbAch)
Enzymes [BR:ret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHE_CH04018 (phbAch)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_CH04018 (phbAch)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABC92762
RhizoBase: RHE_CH04018
UniProt: Q2K324
Position
4253282..4254463
Genome map
AA seq 393 aa AA seqDB search
MSNSSVVIASAGRTAVGSFNGAFATVPAHELGAAVIKGALARAGVDAGEVDEVILGQVLA
AGEGQNPARQAAIKAGLPKETTAWGVNQLCGSGLRAVALGMQQIATGDAKIIVAGGQESM
SMAPHAVHLRGGVKMGDTKMVDTMIKDGLTDAFHGYHMGITAENIARQWQLSRDEQDRFA
VASQNKAEAAQKAGRFTDEIIPYVIQTRKGDVTVDADEYIRHGATLEAMAKLRPAFDKEG
TVTAANASGLNDGAAAAVLMSEAEAVRRGIQPLARIVSWATAGVDPSIMGTGPIPASRKA
LEKAGWSVNDLDLVEANEAFAAQACAVTKDLGWDPAIVNVNGGAIAIGHPIGASGARVLN
TLLFEMKRRGAKKGLATLCIGGGMGVAMCFEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattcatccgtcgtcatcgccagcgcaggtcggacagccgtcggctcgttcaat
ggcgcttttgcaacggtccccgcgcatgaactcggcgcggccgtcatcaagggcgcgctc
gcacgtgccggcgtcgacgccggcgaggtggatgaggtgatcctcggccaggtgctggcc
gcaggcgaaggccagaacccggcccgccaggcggcgatcaaggccgggcttccgaaggaa
acgacggcttggggcgtcaaccagctctgcggctcgggcctgcgcgccgtcgcgctcggc
atgcagcagattgccaccggcgatgccaagatcatcgttgccggcggtcaggaatccatg
tcgatggcgccgcatgccgtgcacttgcgcggcggcgtcaagatgggcgacacgaagatg
gtcgacacgatgatcaaggacggcctgaccgatgccttccacggttatcacatgggcatc
accgccgagaatattgcgcgtcaatggcagctttcgcgcgacgaacaggatcggttcgcg
gtcgcttcgcagaacaaggccgaggccgcccagaaagccggccgctttaccgacgagatc
atcccctatgtcatccagacgcgtaagggcgatgttacggtcgatgccgacgaatatatc
cgccacggcgccacgctggaggctatggccaagctgcgccccgccttcgacaaggagggc
acggtgacggctgcaaatgcctccggcctcaatgacggtgccgcggcagcggtgctgatg
agcgaagcggaagcggtccgccggggcatccagccgctggcccgcatcgtttcctgggca
acggcgggcgtcgatccgtcgatcatgggcaccggcccgatccccgcttcgcgcaaggcg
ctcgaaaaggccggctggtctgtgaacgatctcgatctcgtcgaggccaacgaggctttc
gctgcacaagcctgcgccgtcaccaaggatctcggttgggatcctgccatcgtcaacgtc
aatggcggggcgattgccatcggccatccgatcggcgcttccggcgcgcgcgttctcaac
acgctgctgttcgagatgaagcgtcggggcgcgaagaagggcctggccacgctttgcatc
ggcggcggcatgggtgtcgccatgtgcttcgaggcactttaa

DBGET integrated database retrieval system