KEGG   Rhizobium etli CFN 42: RHE_CH04068Help
Entry
RHE_CH04068       CDS       T00317                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00330  Arginine and proline metabolism
ret00332  Carbapenem biosynthesis
ret01100  Metabolic pathways
ret01130  Biosynthesis of antibiotics
ret01230  Biosynthesis of amino acids
Module
ret_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RHE_CH04068 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RHE_CH04068 (proB)
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RHE_CH04068 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA TruB_C
Motif
Other DBs
NCBI-ProteinID: ABC92811
RhizoBase: RHE_CH04068
UniProt: Q2K2X5
Position
4311277..4312446
Genome map
AA seq 389 aa AA seqDB search
MTSRKPLGRYRRIVIKIGSALLVDRKAGLKKAWLDAMCADIAGLKARGIDVLVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQIALARAWSESLSRDEIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLILLSDIDGL
YTAPPHLDPNATFLETISEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTSGCAMIIA
SGKTESPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDEGAVTALGAGKSL
LPAGLRSVSGLFSRGDTVAIIGPAGREIARGLVSYDAEDARRIAGRKSAEIEAILGYAGR
AAMVHRDDMVMTAQIRPKSERQKKDASYA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgtaagccgcttggccgctaccgccgcatcgtcatcaagatcggctccgcc
cttctggtcgaccgcaaggccgggctgaagaaggcctggctcgacgccatgtgcgccgat
attgcgggcctgaaggccagggggatcgacgtgctcgtcgtttcatcaggggcaatcgcg
ctcggccgctcggtgctcgacctgccctccggcgcgctgaagctcgaggaaagccaggcg
gccgccgccgtcggccagatcgcgctggcgcgcgcctggtcggaaagcctgtcgcgcgac
gagatcgtcgccggccagatcctgctgacactcggcgacaccgaggagcgccgccgctat
ctcaatgcgcgcgccaccatcaatcagcttctgaagatcggcgccgtaccaatcatcaac
gagaacgatacggtcgcgaccagtgaaatccgctacggcgacaacgaccgcctcgccgcc
cgtgtggcgacgatgaccggcgccgacctgctcatccttctctccgatatcgacggcctc
tataccgcgccgccgcatctcgatccgaacgcgaccttcctggagacgatttccgaaatc
acgccggagattgaggcgatggccggcggcgccgcctccgagctttcgcgcggcggcatg
cgcaccaagatcgatgccggcaagatcgccaccacctcgggctgcgccatgatcatcgcc
tcaggcaagacggagagcccgctctcggcgatcgaaaacggcgcgcgctcctcctggttc
gccccttccggcacacccgtgaccgcccgcaagacctggatcgccgggcagttgcagccg
gcaggcgagctgcacgtcgatgagggcgccgtcacggcgctcggcgccggcaagagtctg
cttcccgccggcctgcgcagcgtttccggcctcttcagccgcggcgacaccgtggcgatc
atcggacctgccggccgcgagatcgcccgcggcctagtaagctatgatgccgaggacgcc
cgccgcatcgccggccgcaaatcggcggagatcgaagccatcctcggttacgccgggcga
gccgccatggtccatcgcgacgacatggtgatgaccgcccagatcagaccgaaatcggaa
aggcagaagaaggacgcgagctatgcttga

DBGET integrated database retrieval system