KEGG   Rhizobium etli CFN 42: RHE_CH04107Help
Entry
RHE_CH04107       CDS       T00317                                 

Gene name
purH
Definition
(GenBank) IMP cyclohydrolase/phosphoribosylaminoimidazolecarboxamideform yltransferase protein
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00230  Purine metabolism
ret00670  One carbon pool by folate
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01130  Biosynthesis of antibiotics
Module
ret_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RHE_CH04107 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RHE_CH04107 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ret04147]
    RHE_CH04107 (purH)
Enzymes [BR:ret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     RHE_CH04107 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     RHE_CH04107 (purH)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_CH04107 (purH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-ProteinID: ABC92850
RhizoBase: RHE_CH04107
UniProt: Q2K2T6
Position
complement(4356166..4357782)
Genome map
AA seq 538 aa AA seqDB search
MAVISKKIPAPDKVEIKTALLSVFDKTGIVELAQALSERGVRLLSTGGTYKAIAAAGLAV
TDVSDITGFPEIMDGRVKTLHPTVHGGLLAIRDDNEHQEAMKKHGIEGIDLAVINLYPFE
EVRAAGGDYPTTVENIDIGGPAMIRASAKNHAYVTILTDPNDYAEFKEQLSADAGKTAYA
FRQRMAAKAYARTAAYDAAISNWFAEALSIDTPRHRVIGGVLKEEMRYGENPHQRAAFYV
TGEKRPGVSTAVLLQGKQLSYNNINDTDAAYELVAEFLPERAPACAIIKHANPCGVATGS
SLIEAYQRALACDSVSAFGGIIALNQILDAETAEEIVKLFTEVIIAPDVTEEAKAIVARK
PNLRLLSAGGLPDPRVAGLTAKTVSGGLLVQSRDNGMVEDLELKVVTRRAPTGQELEDMK
FAFKVGKHVKSNAVVYAKDGQTAGIGAGQMSRVDSARIAALKAEEAAKALGLAVPMTKGS
AVASEAFLPFADGLLSMIAAGATAVIQPGGSMRDQEVIDAANEHGIAMVFTGMRHFRH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatttccaaaaagatccccgccccggacaaggtcgaaatcaagaccgcgctc
ctctccgttttcgacaagaccggcatcgtcgagctcgcccaggcattgtccgaaagaggc
gtgcgtctgctgtcgaccggaggtacctataaggcgatcgctgccgccggcctcgccgtc
accgatgtctccgacatcaccggttttccagagatcatggatggccgcgtcaagacgttg
cacccgaccgtgcatggcggcctgctggcgatccgcgacgacaacgagcaccaggaagcg
atgaagaagcacggcatagagggcatcgatctggccgtcatcaatctctatcccttcgaa
gaggtgcgcgcggccggcggcgattatccaacgaccgtcgagaatatcgatattggcggt
ccggcgatgatccgggcatcggccaagaaccacgcctatgtgacaattctgaccgatccc
aacgattatgccgagttcaaggagcagctttcggccgatgccggcaagacggcctatgcc
ttccgccagcgcatggccgccaaggcctatgctcgaaccgcggcctatgacgctgcgatt
tccaactggtttgccgaagcgctgtcgatcgacacgccgcgccaccgcgtcatcggcggc
gtgctgaaggaagagatgcgctacggcgaaaacccgcaccagagggccgccttctatgtc
acgggcgagaaacgcccgggtgtttcgacggctgtgcttctgcagggcaagcagctctcc
tataacaatatcaacgacactgacgccgcctacgagctcgtcgccgagttcctgccggaa
agggcgccggcctgcgccattatcaagcacgccaatccgtgcggcgtcgccaccggttcg
agcctgatcgaagcctatcagcgggcgcttgcctgcgattccgtttccgccttcggcggc
atcatcgcgctcaaccagatcttggacgccgaaacggccgaagagattgtcaagcttttc
accgaggtgatcatcgccccggatgtcaccgaagaggcaaaggcaatcgttgcgcgcaag
ccgaacctccggctcctctcggccggcggcctgcccgatccacgcgttgcagggctgacg
gcgaaaaccgtttccggcggcctgcttgtccagagccgcgacaacggtatggtcgaggat
ctggaactgaaggtcgtcaccagacgtgcgccgacgggccaagagctcgaggatatgaag
tttgccttcaaggtcggaaaacatgtgaaatcaaacgccgtggtctacgccaaggacggc
cagacggccgggatcggcgccggccagatgagccgggtcgattctgcgcgcatcgccgcg
ctgaaggccgaagaagccgccaaggcgctcggactcgcggttccgatgaccaagggttcg
gcggttgcctccgaagccttcctgccctttgccgacggtctcctgtcgatgattgccgca
ggcgcgacggcagtcatccagccgggcggctcgatgcgcgatcaggaggttatcgatgcc
gccaatgaacacggcatcgcgatggtcttcaccggcatgcgtcacttccggcactag

DBGET integrated database retrieval system