KEGG   Rhizobium etli CFN 42: RHE_PA00175
Entry
RHE_PA00175       CDS       T00317                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein E
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RHE_PA00175 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ret02044]
    RHE_PA00175 (trbE)
Enzymes [BR:ret01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     RHE_PA00175 (trbE)
Secretion system [BR:ret02044]
 Type IV secretion system
  Trb secretion system protein
   RHE_PA00175 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG ABC_tran AAA_22 AAA_10 AAA_21 AAA_29 AAA_23 DUF87 ATPase_2 AAA_16 TrwB_AAD_bind FtsK_SpoIIIE T2SSE MC4
Other DBs
NCBI-ProteinID: ABC93037
UNAM_a: RE1PA0000175
RhizoBase: RHE_PA00175
UniProt: Q2K2Q9
Position
p42a:complement(185389..187845)
AA seq 818 aa
MVALKRFRATGPSFADLVPYAGLVDNGVLLLKDGSLIAGWYFAGPDSESATDLERNELSR
QINTILSRLGSGWMIQVEAVRIPTFDYPSDDRCHFPDPVTRAIDAERRAHFAREQGHFES
KHALVLTYRPLESKKTALSKYIYSDEESRKKTYADTVLFIFKNAVREIEQYFANTLSIRR
METRETVERGGERVARYDELLQFVRFCVTGENHPIRLPDAPMYLDWLATAELEHGLTPKV
ENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSSRFIFLDAEEARQKLERTRKKWQQK
VRPFFDQLFQTQSRSVDQDAMTMVAETEDAIAQASSQLVAYGYYTPVIVLFDHDREALQE
KAEAIRRLIQAEGFGARIETLNATDAFLGSLPGNWYCNIREPLINTSNLADLVPLNSVWS
GNPIAPCPFYPPNSPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKSTLLALIAAQF
RRYERAQIFAFDKGSSLLPLTLAAGGDHYEIGGDHNETERALAFCPLSELSNDADRAWAT
GWIEMLVTLQGVAITPDHRNAISRQIGLMASAAGRSLSDFVSGVQMREIKDALHHYTVDG
PMGQLLDAEQDGLSLGAFQTFEIEQLMNMGERNLVPVLTYLFRRIEKRLDGSPSLIVLDE
AWLMLGHPVFRSKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKICLPNG
AAREAGTREFYERIGFNERQIEIVSNAIPKREYYVVTLDGRRLFDMALGPVALSFVGASG
KEDLKRIRALNSEHGRDWPIHWLQTRGVHDAASLLNFE
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggttgctctcaaacgtttccgggccaccggcccctcctttgcggatctcgttccctat
gccggcctggtcgacaatggcgtgctcctgttgaaagacggaagcctgattgccggctgg
tattttgccgggccggattccgaaagcgccacggacctcgagcgcaacgagctctcgcgg
cagatcaatacgatcctgtcgcgtcttggaagcggctggatgatccaggttgaagccgtg
cgcatcccgacattcgactatccgtcggatgatcgttgccactttcccgatcccgtcacg
cgcgcgatcgacgccgagcggcgggcacacttcgcgcgcgagcaggggcatttcgagagc
aagcacgcgctcgtcctcacctatcggccgcttgaatcaaaaaagacggcgctcagcaaa
tacatctactcggacgaggaaagccgaaagaagacctatgcggatacggtgctgttcatt
ttcaagaacgctgtccgggagatcgagcagtatttcgccaacaccctttcaatccgtcgc
atggaaacccgggaaaccgtcgagaggggaggggagcgggtcgcccgctatgacgagctg
ctacaattcgttcgcttttgcgtcacaggcgagaaccatccgatccggctgccggatgcc
ccgatgtatctcgattggcttgcaactgccgagctcgagcatggcctgacgccgaaggtc
gaaaaccgtttcctcggcgtcgtggcgatcgacggactgccggccgagagctggccggga
attctcaacagcctggatctgatgccgctcacttatcgctggtcatcgcgcttcatcttc
ctcgatgcggaagaggcgcggcaaaaactcgaacgcacccgtaagaagtggcagcagaag
gtgcggccgttcttcgatcagctcttccagacgcagagccggtcggtagaccaggacgcg
atgaccatggtggccgagacggaagacgccatcgcccaagcctcctcgcagctggtggcc
tatggctactatacgccggtgatcgttctctttgatcacgaccgggaggccctgcaggaa
aaagcagaagcaatccgccggctgatccaggcggagggattcggcgcgcggatcgagacg
ctcaacgccaccgacgcctttctcggcagcctgcccggcaactggtactgcaatatccgc
gaaccgctgatcaacacgagcaatctcgccgatctggttccgcttaactctgtctggtca
ggcaatccgatcgcgccgtgcccattctatccgccgaactcgccgccgttgatgcaggtg
gcgagtgggtcgacgccgttccggctgaacctgcatgtcgacgatgtcggccacacgctg
attttcgggccgaccggttcggggaagtcgacgctgctggcactgattgccgcacagttc
cgccggtatgaacgggcccagatcttcgccttcgacaaggggagctcgctgctaccgctg
acgctcgccgccggtggcgatcactatgagattggtggagatcacaacgaaacggagagg
gcactggccttttgtccgctatcggagctctccaatgatgcagatcgcgcatgggccacg
ggatggatcgaaatgctggtgacgctgcagggtgttgccatcacccctgatcatcgcaac
gccatttcgcgccagattgggttgatggccagcgcagccggtcgatcgctttcggacttc
gtcagcggcgtgcagatgcgcgagatcaaggacgcgctccaccactacacggtcgacgga
ccgatgggccagcttctcgatgcggaacaggatggtctctcgctgggtgccttccagact
ttcgaaatcgagcaactgatgaacatgggcgagcgcaatctcgtgcccgtgctcacctat
ctgttccgacgtatcgagaagcgtctcgacggctcaccgagcctgatcgtcctggacgag
gcctggttgatgctcggccatccggtattccgtagcaagatccgcgaatggcttaaagtg
ctacgcaaggccaactgcgccgttgtgctcgccacgcagtcgatttcggatgccgagcgt
tccgggatcatcgacgtgctgaaggaatcctgcccaacgaaaatctgcctgcccaacggc
gcagccagggaggcggggacccgcgagttctatgagaggatcgggttcaatgagcgacag
atcgagatcgtttcgaacgcaatccccaagcgcgaatattacgtggtcacccttgatggc
cggcgcctattcgatatggcgctcggtcccgtggcgctcagcttcgtcggcgcatcgggc
aaggaagacttgaagcgcatccgcgcgctcaattccgaacacggccgcgactggccgatc
cactggcttcaaacgagaggagttcacgatgccgcatcgctgctcaacttcgaatag

DBGET integrated database retrieval system