KEGG   Rhizobium etli CFN 42: RHE_PA00176
Entry
RHE_PA00176       CDS       T00317                                 
Symbol
trbD
Name
(GenBank) conjugal transfer protein D
  KO
K20529  type IV secretion system protein TrbD
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RHE_PA00176 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ret02044]
    RHE_PA00176 (trbD)
Secretion system [BR:ret02044]
 Type IV secretion system
  Trb secretion system protein
   RHE_PA00176 (trbD)
SSDB
Motif
Pfam: VirB3 Glucos_trans_II TMEM210
Other DBs
NCBI-ProteinID: ABC93038
UNAM_a: RE1PA0000176
UniProt: Q2K2R2
Position
p42a:complement(187855..188154)
AA seq 99 aa
MAESLSGLQRNRIHRALSRPNLLMGADRELVLITGLAAVILIFVVLTVYSALFGVAVWIV
IVGLLRMMAKADPLMRQVYVRHISYKHYYKATSSPWRRY
NT seq 300 nt   +upstreamnt  +downstreamnt
atggctgagtccctgtccgggctgcaacgcaaccgcatccaccgtgcgctgtcgcggccg
aacctcctgatgggcgcggaccgggaactggtgctgatcaccggccttgccgcagtcatt
ctgatcttcgtcgtcctcacggtctattccgcgctcttcggcgttgccgtctggatcgtc
atcgtcgggcttttgaggatgatggccaaggccgatccgctgatgcgacaggtttatgtc
cgccatatctcctacaagcattactacaaggcgacctcctcgccgtggcgccggtattga

DBGET integrated database retrieval system