KEGG   Rhizobium etli CFN 42: RHE_PB00144
Entry
RHE_PB00144       CDS       T00317                                 

Definition
(GenBank) probable phosphoglycerate oxidoreductase protein
Organism
ret  Rhizobium etli CFN 42
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD NAD_binding_2
Other DBs
NCBI-ProteinID: ABC93186
UNAM_b: RE1PB0000144
RhizoBase: RHE_PB00144
UniProt: Q2K273
Structure
PDB: 
4HY3

Position
p42b:complement(158807..159838)
AA seq 343 aa
MTNTERPLAISAPEPRSLDLIFSDEARAALHSKYEIVEADPENIAGLGDDILGRARYIIG
QPPLSAETLARMPALRSILNVESNLLNNMPYEVLFQRGIHVVTTGQVFAEPVAEIGLGFA
LALARGIVDADIAFQEGTELWGGEGNASARLIAGSEIGIVGFGDLGKALRRVLSGFRARI
RVFDPWLPRSMLEENGVEPASLEDVLTKSDFIFVVAAVTSENKRFLGAEAFSSMRRGAAF
ILLSRADVVDFDALMAAVSSGHIVAASDVYPEEPLPLDHPVRSLKGFIRSAHRAGALDSA
FKKMGDMVLEDMDLMDRGLPPMRCKRAERETVSRMRSKPVAVN
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgacgaacactgaacggccgctggcaatcagcgcgcccgagccgcgctcgctcgatctg
atcttcagcgatgaagcgcgcgccgcactgcattcgaaatacgagattgtcgaagccgat
cccgaaaatatcgccgggcttggcgacgatatcctcggcagggcgcgatacatcattgga
cagccgccgctctcagccgaaacgctggccaggatgcctgccttgcgctcgatcctaaac
gtcgagagcaatctcttgaacaacatgccctacgaggtgcttttccagcgcggcattcat
gtcgtcacgacagggcaggtctttgcagagccggtcgccgaaatcggcctcggcttcgcg
ctggcgcttgcgcggggcatcgtcgatgcggatatcgctttccaagagggcaccgaactc
tggggaggggagggcaatgccagcgcccggctgatcgccggctcggagatcggcatcgtc
ggcttcggcgatctcggcaaggccctgcgccgggttctgtccggcttcagggcgcgcatc
agagtgttcgatccctggctgccccgctcaatgctcgaggaaaacggcgtcgaaccggca
agcctggaggatgtcctgacgaagagcgatttcatctttgtcgtcgcagccgtcaccagc
gaaaataagcgatttctcggcgccgaggccttttccagcatgcgcaggggcgcggccttc
atcctgctcagccgcgccgacgtcgtcgatttcgacgcattgatggcggccgtttcgtca
ggccatatcgtcgccgcaagcgacgtctaccctgaggagccgctgccgcttgatcatccg
gtacgcagcctgaaaggcttcatccgctcggcacaccgggccggtgcgctcgacagcgcc
ttcaagaagatgggcgatatggtgctcgaggacatggacctgatggatcgcggcctgccg
ccgatgcgctgcaagcgggcggagcgcgagacggtctcccgcatgcgctccaagccggtc
gcggtgaattga

DBGET integrated database retrieval system