KEGG   Rhizobium etli CFN 42: RHE_PC00026Help
Entry
RHE_PC00026       CDS       T00317                                 

Gene name
dhaS
Definition
(GenBank) aldehyde dehydrogenase protein
  KO
K23463  (Z)-2-((N-methylformamido)methylene)-5-hydroxybutyrolactone dehydrogenase [EC:1.2.1.-]
Organism
ret  Rhizobium etli CFN 42
Brite
KEGG Orthology (KO) [BR:ret00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RHE_PC00026 (dhaS)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RHE_PC00026 (dhaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 IlvGEDA_leader
Motif
Other DBs
NCBI-ProteinID: ABC93233
UNAM_c: RE1PC0000026
RhizoBase: RHE_PC00026
UniProt: Q2K173
Position
p42c:22413..23876
Genome map
AA seq 487 aa AA seqDB search
MRRFQHYIDGEFSDGEASYPSIDPATGAAWAEMPEAREGDVDRAVNAAEKALYEGPWAKM
TATQRGKLLYKLADLVAANAQVLAELETRDTGKIIRETSAQIAYVAEYYRYYAGISDKIE
GSYLPIDKPDMDVWLRREPIGVVAMVVPWNSQLFLSAVKIGPALAAGCTMVVKASEDGPA
PLLEFARLVHEAGFPAGVVNIITGFGPSCGAALGRHPKVAHVAFTGGPETARHVVRNSAE
NLASTSLELGGKSPFIVFADADLESAANAQVAGIFAATGQSCVAGSRLIVERSVKDRFVA
LLRQKAAAIRIGAPLDMATEVGPLATKRQQDNIGVLIERSIESGARLVTGGRKIDGEGYY
FPPTILDCDDVASPSLIEEFFGPVLSVVSFETEAEALKLANDTRYGLASGIFTQNLTRAH
RLMKAIRAGIVWVNTYRAVSPIAPFGGFGLSGHGREGGMAAALDYTRTKTIWLRTSDDPI
PDPFVMR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtttccagcattacatcgatggcgaattctcggatggcgaagcttcctacccg
agcatcgatccggcgaccggcgcagcctgggcggagatgccggaagcgcgcgaaggtgat
gtcgaccgggccgtgaatgctgccgagaaggcgctctacgagggtccctgggcgaagatg
acggccacgcagcgaggcaagctgctctataagctcgccgatctcgttgccgccaacgcg
caggtgctcgccgagctcgagacccgcgacaccggcaagattatccgcgagacatcggcg
cagatcgcctatgtcgcggaatattaccgctattatgccggcatatcagataagatcgaa
ggctcctacctgccaatcgacaagcctgacatggatgtctggcttcgccgcgagccgatc
ggcgtcgtcgccatggtcgtgccatggaacagccagctctttctgtcagcggtcaagatc
ggcccggcgctcgccgccggctgcacgatggtggtgaaggcctcggaagatgggccggcg
ccgcttctcgaatttgcgcgtctcgtgcatgaggcaggctttcccgccggcgtcgtcaac
atcatcaccgggttcggcccctcctgcggggcggccctcggccgtcacccgaaggtcgcc
catgtcgccttcaccggcggcccggaaaccgcccggcacgtcgtgcgcaactcggccgaa
aacctcgcttccacctcgcttgaactcggcggcaagtcgcccttcatcgtctttgccgac
gccgatctcgaaagcgccgccaacgcccaggtcgccggcatcttcgccgcgacgggacag
agctgcgtcgccggctcgcggctgatcgtcgagcgcagcgtcaaggacaggttcgtcgcg
ctgctgcggcagaaggcggcagcaatccggatcggcgcgccgctcgacatggcgaccgaa
gtcggcccgcttgccaccaagcgccagcaggacaatatcggcgttcttatcgagagatcg
atcgaaagcggcgcccgcctcgtcaccgggggacgcaagatcgacggcgaaggctattat
ttcccgccgacgatcctcgattgcgacgatgtcgcttcgccctcgctgatcgaggaattc
ttcgggccggtcctctccgtcgtctccttcgagaccgaggccgaggcgctgaagctggcc
aacgatacccgctacggcctggcttccggcattttcacgcagaacctcacccgtgcgcac
cggctgatgaaggccatccgcgccgggatcgtctgggtcaacacctaccgcgccgtatcg
ccgatcgcgcccttcggcggcttcggcctgtcgggccacggcagggaaggcggcatggcc
gcggcgctcgattatacccgtaccaagacgatctggctgaggacctccgacgatccgatc
cccgatcccttcgtgatgaggtga

DBGET integrated database retrieval system