KEGG   Rhizobium etli CFN 42: RHE_PC00128Help
Entry
RHE_PC00128       CDS       T00317                                 

Definition
(GenBank) probable acyl-CoA synthetase protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00010  Glycolysis / Gluconeogenesis
ret00620  Pyruvate metabolism
ret00640  Propanoate metabolism
ret00680  Methane metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_PC00128
   00620 Pyruvate metabolism
    RHE_PC00128
   00640 Propanoate metabolism
    RHE_PC00128
  Energy metabolism
   00680 Methane metabolism
    RHE_PC00128
Enzymes [BR:ret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RHE_PC00128
Lipid biosynthesis proteins [BR:ret01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RHE_PC00128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding Coatomer_g_Cpla
Motif
Other DBs
NCBI-ProteinID: ABC93334
UNAM_c: RE1PC0000128
RhizoBase: RHE_PC00128
UniProt: Q2K1H4
Position
p42c:134729..136783
Genome map
AA seq 684 aa AA seqDB search
MTSKPLDRLLRPQTIAVFGGREARRVIEQCDRMGFSGQIWPVHPKLEEVLGRPCYRSVSD
LPSAPDAAFVGVNRTLTVEIVRSLSDAGAGGAVCYASGFSEATAELADGTELQQALMEAA
GDMPILGPNCYGLINGLDGALLWPDQHGMKRIERGVAILTQSSNIALNLTMQTRGLPIAY
MVTAGNQAQTSLADIASALMEDQRVTAIGLHVEGFGDLAALERLAAIARRLKKAVVVLKV
GRSEQAKHAAVSHTASLAGSDAVADAMLTRLGLGRVQSLPALLETLKLLHIAGPLPSHSI
SSMSCSGGEASLMADAAVGREVEFPALQPQQLPRLRQVLGDMVALSNPLDYHTFVWGDFE
RQAEAFRAMFEGGYALNLVVLDFPRGDRCDAAEWATTVDAVIAAASATGTLAGLLATLPE
NMPEPIADRLMANGIIAFSGIDEAIIAAEAAAGIGKVWDRPPPLPLLDVPSMDGEIETLT
EADAKTELAACGLPVPWGLQAFSPREAAEQAERLGFPVVLKGLGIAHKTEAGAVVLNLRD
PEAVSNAAAAMPANGGYLIEKMIDPPVAELIVGATRDPVFGLSLTLGAGGIFVELLDDSI
VLPLPATKAEIRDALLGLKIAKVIHGYRGRPRGDLDAAVDAVAAAAEYVVKNAVRLEELD
LNPLMVLPEGRGVVAVDALIRRRR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaaaccgctcgaccgcctgctcagacctcaaacgatcgccgtcttcggcggt
cgcgaggcgcgcagggtgatcgagcaatgcgaccgcatgggcttttcgggccagatctgg
cccgtccatcccaaactcgaggaggtgcttggacggccgtgttatcgctctgtatccgat
ctgccttctgccccggacgctgctttcgtgggtgtcaacaggacgctgacggtcgagatc
gtgcgcagcctttcagacgccggcgccggtggagcggtctgctatgcatcgggcttcagc
gaggcgacggcggaacttgccgacggcaccgaactgcagcaggcccttatggaggcggcg
ggtgacatgccaatccttgggccgaactgctacgggctgatcaacggtctcgatggcgcc
ctgttatggcccgaccagcacggcatgaaacgcatcgaacgcggcgtcgcgatcctcaca
caatcctccaatatcgccctcaacctcaccatgcagacccgcgggctgccgatcgcctat
atggtcactgcgggcaaccaggcgcagacatcgcttgccgatatcgccagcgcgctgatg
gaggatcagcgggtcacggcgatcggtcttcatgtcgagggtttcggcgacctcgcggcc
ctagaacgccttgcagccatcgcccgccggttgaagaaggcggtcgtcgtgctgaaggtc
ggcaggtccgagcaggcgaaacacgcggccgtatcccacaccgcctcgctcgccggcagc
gacgcggtggcggatgccatgctcacccgtctcggtctcggccgtgtccagagcctgccg
gcgctgcttgaaaccctaaaattactgcatatcgccggccctctcccgagccattcgatc
tcgtccatgagctgctccggcggcgaggcttcgctgatggcggatgccgccgtcggccgc
gaggtggaattcccggcgctgcagccacaacaattgccgcgtctgcgtcaggtcctcggc
gatatggtggcgctttcaaatccgctcgactaccacaccttcgtctggggcgatttcgaa
cgccaggccgaagccttcagagccatgttcgaaggcggttatgccctcaatctcgtcgtt
ctcgacttcccgcgtggcgaccgctgcgatgcggccgaatgggcgacgacggtggatgcg
gtgatcgccgccgcctctgccaccggtacactggccggccttctcgcaacccttccggag
aatatgccggagccgatcgccgatcgtctcatggcgaatggcatcatcgccttttcgggc
atcgacgaagccattattgcggcggaagccgccgccggtattggcaaggtctgggatcgc
ccgcctcccctgccgctgctcgacgtgccgtccatggacggcgaaatcgagacgctgacg
gaagccgacgcgaagacggaacttgctgcctgcggcctccctgttccctgggggctgcag
gctttttctcctcgcgaagccgccgagcaggccgagcggctcggttttcccgtcgtgctg
aagggtctcggcattgcgcacaagaccgaggccggcgctgtcgttctcaacctcagagat
ccggaggcggtgtcaaatgcggcggcagcgatgccggcgaatggcggttacctcatcgag
aagatgatcgatccgccggtcgccgagctcattgtcggggctacccgcgatcctgtattc
ggtttgtcgctcaccttgggagctggcggaatattcgtcgaactgcttgacgattccatc
gttttgccgctgcccgcaacaaaggccgaaattcgcgacgcgcttttgggcctcaagatt
gctaaggtgatccatggctatcgtgggcggccgaggggtgatctcgacgccgccgtagac
gctgtcgcagctgcggcagaatatgtcgtaaaaaatgcggtgcgcctggaggaactggac
cttaatccgttgatggttctgcccgaagggcgcggtgttgttgcagttgatgctctcata
cgccgaaggaggtag

DBGET integrated database retrieval system