KEGG   Rhizobium etli CFN 42: RHE_PC00143Help
Entry
RHE_PC00143       CDS       T00317                                 

Definition
(GenBank) probable D-2-hydroxyacid dehydrogensase protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored 3HCDH_N NAD_binding_7 AdoHcyase_NAD ThiF XdhC_C NAD_Gly3P_dh_N Gp_dh_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABC93349
UNAM_c: RE1PC0000143
RhizoBase: RHE_PC00143
UniProt: Q2K1I6
Position
p42c:complement(154686..155579)
Genome map
AA seq 297 aa AA seqDB search
MVDLEATYRVHRLWEAADRQELISKVGSNIRAIATRGELGASAELMKQLPKLEIVSCYGV
GTDAIDLSYARANGIRVTNTPDVLTEDVADIAIGLLLSTARQIPQADVFVRTGQWGKIPM
PLVRRVSGKKVGIVGMGRIGKAIAKRAAAFGCDISYFARNRDQDVAHGYEANLVALANWA
DFLIVIVPGGAATMKIINAEVLEALGPEGMLINVSRGTTVDEEALIAALQNRTIQAAGLD
VFLNEPKIDERFLTLPNVVLQPHHGSGTIETRKAMGQLVRDNLAAHFAGQALPTPVV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatctggaggcgacctaccgcgtccaccgcctgtgggaagccgcggatcgtcag
gaattgatttcgaaagtcggcagcaatatccgcgccatcgcgacgcgcggcgaactcggc
gcctccgccgagctgatgaagcaattgccgaagctggaaatcgtttcttgttacggcgtc
ggcaccgacgccatcgacctctcctatgcccgcgccaacggcattcgcgtgacgaacacc
cctgacgtgctgaccgaagacgtcgccgatatcgccatcggactgctgctttccacggca
cggcagattccgcaggccgacgtattcgtccgcaccggccagtggggcaagattcccatg
ccgctggtgaggcgggtttcgggcaagaaggttgggatcgtcggcatggggcggatcggc
aaggcgatcgccaagcgggctgccgctttcggctgcgacatctcttatttcgcccgcaat
agggaccaggatgtcgcccatggttatgaagccaatctggtcgcgcttgccaattgggcc
gactttctgatcgtcatcgttcccggaggggccgcgaccatgaagatcatcaacgccgag
gtgcttgaagcgctcggtccggaaggcatgctgatcaacgtttcgcgcggaacgaccgtc
gacgaggaggcactgatcgcagcgcttcagaaccgcaccatccaggccgcaggccttgac
gttttcctcaacgagccgaaaatcgatgagcgcttcctgacgctgccaaatgtggtgctg
cagccccaccacggctccggcaccatcgagacccgcaaggccatgggtcagttggtgcga
gacaatctcgctgcacattttgccggtcaggcgctgccaactcccgtcgtgtga

DBGET integrated database retrieval system