KEGG   Rhizobium etli CFN 42: RHE_PD00145
Entry
RHE_PD00145       CDS       T00317                                 
Name
(GenBank) transport secretion system IV, VirB3 protein
  KO
K03198  type IV secretion system protein VirB3
Organism
ret  Rhizobium etli CFN 42
Pathway
ret03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ret00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RHE_PD00145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ret02044]
    RHE_PD00145
Secretion system [BR:ret02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RHE_PD00145
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: AAM54905
RhizoBase: RHE_PD00145
UniProt: Q8KIM7
Position
p42d:162871..163209
AA seq 112 aa
MASIPSLEDDTLFLACTRPAMIAGVTMEAMGVNIMLTTILYITAGSIAYALVGIVFHVLF
RALVKHDHNMFRILIAWIETRGRSRNTAYWGGATLSPLTLTRRYDERDLSFV
NT seq 339 nt   +upstreamnt  +downstreamnt
atggcgagcattccgagtctcgaagacgacacgttgtttctcgcctgcacgcgcccggca
atgatcgctggcgtgacgatggaggcgatgggcgtcaacatcatgctgacgaccatcctt
tatatcactgcgggatcaatcgcctacgcgctggtcggtatcgttttccatgtcctgttt
cgcgcgctcgtcaagcacgaccacaatatgtttcggatcctgattgcgtggatcgaaacc
cgtggccgctcccgcaataccgcgtattggggcggcgccacgctctcgcctctgacgctc
acccggcgttatgacgaaagggatctcagctttgtctaa

DBGET integrated database retrieval system