KEGG   Rhizobium etli CFN 42: RHE_PF00014Help
Entry
RHE_PF00014       CDS       T00317                                 

Gene name
phbAf
Definition
(GenBank) acetyl-CoA acetyltransferase (beta-ketothiolase) protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00071  Fatty acid degradation
ret00072  Synthesis and degradation of ketone bodies
ret00280  Valine, leucine and isoleucine degradation
ret00310  Lysine degradation
ret00362  Benzoate degradation
ret00380  Tryptophan metabolism
ret00620  Pyruvate metabolism
ret00630  Glyoxylate and dicarboxylate metabolism
ret00640  Propanoate metabolism
ret00650  Butanoate metabolism
ret00900  Terpenoid backbone biosynthesis
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
ret01212  Fatty acid metabolism
ret02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHE_PF00014 (phbAf)
   00630 Glyoxylate and dicarboxylate metabolism
    RHE_PF00014 (phbAf)
   00640 Propanoate metabolism
    RHE_PF00014 (phbAf)
   00650 Butanoate metabolism
    RHE_PF00014 (phbAf)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHE_PF00014 (phbAf)
   00072 Synthesis and degradation of ketone bodies
    RHE_PF00014 (phbAf)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHE_PF00014 (phbAf)
   00310 Lysine degradation
    RHE_PF00014 (phbAf)
   00380 Tryptophan metabolism
    RHE_PF00014 (phbAf)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHE_PF00014 (phbAf)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHE_PF00014 (phbAf)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHE_PF00014 (phbAf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ret04147]
    RHE_PF00014 (phbAf)
Enzymes [BR:ret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHE_PF00014 (phbAf)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_PF00014 (phbAf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABC93908
UNAM_f: RE1PF0000014
RhizoBase: RHE_PF00014
UniProt: Q2JZS8
Position
p42f:13624..14829
Genome map
AA seq 401 aa AA seqDB search
MILSYAYQPDEDWQPVVVAAYRTPIGRAFGSLATVAAEDLLAPIIRRILAETGVGPDAID
DVLVGNAAGGGGNIGRLAALTAGLPMAVPGVAIDRQCGSGLEAIIMAARLIQAKAGSCFL
AGGVESVSTAPWRVERPKANGAVPRFYGRARFSPETIGDPEMGVAAENVARQFGISRQRQ
DEFALRSHRLAVAAAEAGLFRPEIVEITTMRGPVEWDECPRPTTSPEALANLKPVFLADG
SVTAGNACPVNDGACLVLVMSRGMARNLGIEKGLAFIDSAAAGVDPNLLGIGPVAATGKL
MQRQPDLSLSAIDVIEFNEAFAAQVLASLDQLEIPANAVNKEGGAIALGHPFGASGAILV
TRLYGQLIRGDGWTPRATGLAMIGIGGGIGLTALFEAVRLF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgtcctacgcctatcagcctgacgaggattggcagccggtcgtggtcgccgcc
taccgcacaccgatcggccgggccttcggctcgctggctacggttgcggccgaagacctg
cttgcgcccatcatccgccgcatccttgcagaaacgggcgtcgggcccgacgccatcgac
gacgtgctggtcggcaatgccgccggcggcggcggcaatatcggccggctggcggcgctg
actgccggcctgcccatggccgttcctggtgttgcgatcgaccggcaatgtggttcgggc
ctcgaagcaatcatcatggccgcccggctgatccaggcgaaggccggttcgtgcttcctt
gccggcggcgtcgaaagcgtcagcaccgcgccatggcgcgtcgaaagaccgaaagccaat
ggtgccgtgccgcgcttttacggccgcgcacggttttcgcctgaaacgatcggcgacccc
gagatgggggtagccgctgaaaacgtcgcccgtcaattcggcatctcgcgccagcggcag
gatgaattcgcccttcgcagccatcggctcgctgtcgcagcggccgaagcgggcctcttc
cgccccgagatcgtcgagatcaccaccatgcgtggcccggtagagtgggacgaatgtccg
cgcccgaccacctcgcccgaggcgctcgcgaacctgaagcctgtcttcttggccgatggc
tcggtgacggcaggcaatgcttgccctgtgaatgacggcgcctgcctggtgctcgtcatg
agccgcggcatggccagaaacctcggcatagaaaagggcctcgccttcatcgacagcgcc
gccgccggcgtcgatccaaacttgctcggaatcggaccggtcgccgcgaccggcaagctc
atgcagcgccagcccgacctctcgctttccgcaatcgacgtcatcgaattcaacgaggct
ttcgccgcccaggtcctggcgtcgctcgatcagctggagatccccgccaacgcggtcaac
aaagaaggcggcgctatcgcgctcggccaccccttcggcgcctccggcgctatcctggtc
acccggctctacggtcagctcatccgcggcgacggctggacaccacgcgcaaccggcctc
gccatgatcggcatcggcggcggcatcgggctcaccgcgttgttcgaggctgtccgcctt
ttctga

DBGET integrated database retrieval system