KEGG   Rhizobium etli CFN 42: RHE_PF00042Help
Entry
RHE_PF00042       CDS       T00317                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisphosphate carboxylaseoxygenase, large subunit protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00630  Glyoxylate and dicarboxylate metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RHE_PF00042 (rbcL)
Enzymes [BR:ret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RHE_PF00042 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABC93936
UNAM_f: RE1PF0000042
RhizoBase: RHE_PF00042
UniProt: Q2JZQ0
Position
p42f:complement(43019..44272)
Genome map
AA seq 417 aa AA seqDB search
MITLTYRIETPGSVETMADKIASDQSTGTFVPVPGETEELKSRVAARVLAIRPLENARHP
TWPESAPDTLLHRADVDIAFPLEAIGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPEAF
RSAHPGPQFGIAGSRRLTGVEGRPIIGTIVKPALGLRPHETAELVGELIGSGVDFIKDDE
KLMSPAYSPLKERVAAIMPRILDHEQKTGKKVMYAFGISHADPDEMMRNHDIVAAAGGNC
AVVNINSIGFGGMSFLRKRSSLVLHAHRNGWDVLTRDPGAGMDFKVYQQFWRLLGVDQFQ
INGIRIKYWEPDESFVSSFKAVSTPLFDAADCPLPVAGSGQWGGQAPETYERTGRTIDLL
YLCGGGIVSHPGGPAAGVRAVQQAWQAAVAGIPLEVYAKDHPELAASIAKFSDGKGA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgataaccctgacctaccgcatcgaaacgcccggcagcgtcgagacgatggcggacaag
atcgccagcgaccagtcgaccggaaccttcgtgccggttcccggcgagacggaagagctg
aaatcgcgcgtcgccgcccgggttttggcgatccgcccgctcgagaatgcgcgccatccg
acctggcccgagtccgcgcccgacacgctgctccaccgcgccgacgtcgacattgccttc
cctctggaggcgatcggcacagatctctcggcgctgatgaccatcgcgatcggcggcgtc
tattcgatcaagggcatgaccggcatccgcatcgtcgacatgaagctgcccgaagctttc
cggagcgcccatcccgggccgcaattcggcatagcgggcagccgccgcctcaccggcgtc
gagggccgcccgatcatcggcacgatcgtcaagccggcactggggctgaggccgcacgag
acggcggaactcgtcggcgaattgattgggtcgggcgtcgacttcatcaaggacgatgag
aagctgatgagcccggcctattcgccgctcaaggagcgcgtcgccgcgatcatgccgcgc
attctcgatcacgagcagaagaccggcaagaaggtcatgtatgccttcggcatctcgcat
gccgatcccgacgagatgatgcgcaaccacgatatcgtcgctgcggccggcggcaattgc
gccgtcgtcaatatcaattcgatcggcttcggcggcatgagcttcctgcgcaagcgctcc
agcctggtgctgcatgcgcatcgcaacggctgggatgtgctgacgcgcgatccgggcgcc
ggcatggatttcaaggtctatcagcagttctggcggctgctcggcgtcgaccagttccag
atcaacggcatcagaatcaaatattgggagccggacgagagcttcgtctcttccttcaag
gccgtcagcacgccgctcttcgatgccgccgattgcccgcttccggtcgcgggctccggc
cagtggggcgggcaggcgccggagacctacgagcgcaccggccgcaccatcgatcttctc
tatctctgcggcggcggcatcgtcagccatcccggcggtcctgctgccggcgtgcgcgcc
gtgcagcaggcctggcaggcggcggtcgccggcattccgctggaggtctatgccaaggat
catccggagcttgccgcctcgattgccaaattcagcgacggcaagggcgcgtga

DBGET integrated database retrieval system