KEGG   Rhizobium etli CFN 42: RHE_PF00379Help
Entry
RHE_PF00379       CDS       T00317                                 

Definition
(GenBank) putative phosphoglycerate dehydrogenase protein
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00260  Glycine, serine and threonine metabolism
ret00680  Methane metabolism
ret01100  Metabolic pathways
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
ret01230  Biosynthesis of amino acids
Module
ret_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    RHE_PF00379
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_PF00379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ret04147]
    RHE_PF00379
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     RHE_PF00379
    1.1.1.399  2-oxoglutarate reductase
     RHE_PF00379
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_PF00379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABC94269
UNAM_f: RE1PF0000379
RhizoBase: RHE_PF00379
UniProt: Q2JYR7
Position
p42f:complement(427557..428531)
Genome map
AA seq 324 aa AA seqDB search
MSFIFSTHPLHPAAKAMLQGAGDLRIASAPDPETLLREGRGAGIVIVRAPIPPVFFEDAP
ALRAAIRHGAGLDMVPMEAATRAGVLVANVPGVNASTVAEHVFLVTLALLRRFRQMDGDL
RQNGWAAGRAQADAAVDLGGRTMGIVGMGNVGKAIFKIAKFGFGLEVVATSRSPGSVPEG
ARFLTIDELVALADILVLCCPLTPGTTGLLHAGRIARMRPDAILVNVSRGPVVDDAALIE
ALRGGRIGGAALDVFATQPLPLDHPYFGFANVIVTPHLAGLTEESMMRMGTGAASEALRV
IKGDLPVNLRNPEVVEHYRRRFPT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcatcttttccacacatcccctgcaccccgcggccaaggccatgcttcaggga
gcgggtgatctgcgtatcgcgtccgcgcccgatcccgaaaccttgctgcgagaaggacgg
ggtgcgggcattgtcatcgtgcgcgcgccgatcccgccggttttcttcgaggatgcgccg
gcgctccgtgcggcgatccgccatggtgccggcctcgacatggtgccgatggaggcggcg
acccgcgccggtgtgcttgtcgccaacgtgcctggtgtcaatgcgtcgactgtcgccgaa
catgtgttcctggtgacactggctctgctcaggcgcttccgccagatggacggggacctg
cgtcagaacggctgggcagcaggccgcgcccaggcggatgctgccgtcgacctcggcggc
cgcactatgggtatcgtcggcatgggcaatgtcgggaaggcgatcttcaagattgcaaag
ttcggctttggcctcgaggtggtcgccacgagccggtcgccgggaagtgtgccggagggc
gcgcgcttcctgacaatcgatgagctcgtcgcgctggccgatatccttgtgctttgctgc
ccgctgacgcccgggacaactggcttgctccatgccgggcgcatcgctcggatgaggccc
gatgccattctggtcaacgtttcgcgcggtcccgtggtcgatgacgcggcgctgatcgag
gccttgcgcggcggccgcatcggcggagcggcgctcgacgtctttgctacgcaaccactg
ccgttagatcatccctatttcggctttgccaacgtcatcgtcactccgcatctggctggt
ctgacggaagagagcatgatgcgcatgggaacaggcgcggccagcgaagcgctgcgcgtc
atcaaaggcgacctgcccgtcaatttgcggaatcccgaagtggtagagcactaccgccgg
cgctttccgacataa

DBGET integrated database retrieval system