KEGG   Rhizobium etli CFN 42: RHE_PF00534Help
Entry
RHE_PF00534       CDS       T00317                                 

Definition
(GenBank) probable aldehyde dehydrogenase protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00040  Pentose and glucuronate interconversions
ret00053  Ascorbate and aldarate metabolism
ret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RHE_PF00534
   00053 Ascorbate and aldarate metabolism
    RHE_PF00534
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     RHE_PF00534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABC94423
UNAM_f: RE1PF0000534
RhizoBase: RHE_PF00534
UniProt: Q2JYB3
Position
p42f:599925..601448
Genome map
AA seq 507 aa AA seqDB search
MTINGNLLVAGTEKRGPNGEFHGIEAATGKPLPISFGGASPEDVEQAAEQAWQAFATYRE
TDLEVRAKFLEKIAEEIEAIGDDLVVRAMAETGLPRGRLEGERARTTGQLRLFAREVREG
RFQELRFDAGDPSRKPVAKPDLRLRNVALGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVVKAHSAHPGTSELVGRAVQRAVSSTGFHPGTFSLLFDTGFEVGQRLVADSRIRAVGFT
GSRRGGTALMEIASKRKQPIPVYAEMSSINPVILFPGALNARATDIAAGFVTSLVLGAGQ
FCTNPGLILAIDGAALDAFVARTAELLRDVAPQAMLTPSIAKAYCDGVAKLRQHSEVRAV
ASGRPGSEFEGTAALFETTADAFLANHQLQDEVFGAAGLVVRCRDLQQLEAVLDELEGQL
TVALHIADEDEAAARRLVPKLEMLAGRLLVNGFGTGVEVSPAMVHGGPYPATADGRSTSV
GTLAIYRFLRPVSYQDFTKALLPAALR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaacggaaacctgctcgttgcgggaacggaaaaacgtggcccaaacggtgag
tttcatggcatcgaagcggccaccggaaagccccttcccatttccttcggtggcgcttcg
cccgaagatgtcgagcaggcagccgaacaggcatggcaggcctttgccacctaccgcgag
accgatctggaagtcagagcaaaatttctggaaaagattgccgaggaaattgaagcgatc
ggcgatgatctcgttgtccgcgcgatggcggaaaccgggctcccccggggacgtctcgag
ggggagcgggcgcgcacgaccggccagctccgcctgttcgccagggaggtccgtgaaggc
cgcttccaggagctgcgcttcgatgcaggcgatccttcccgcaaacccgttgcgaagccg
gatctcaggctcagaaacgtcgcgctcggccccgtggcagtctttggcgcctcgaatttt
ccgctcgccttctccgtcgccggcggcgacacggcgtccgcgctggccgcgggctgcccg
gtcgtagtaaaggcccattcggcgcatccgggcacttcggagctcgtcggccgggcggtg
cagcgggcagtctcaagcacaggtttccatccaggaaccttctcgctgctgttcgacacc
ggctttgaagtcggtcagaggctcgtggcggattccaggatccgggcggtcggctttacc
ggctcccgccgcgggggaacggcactgatggaaatcgcctcaaagcgcaaacaacccatc
cccgtctatgccgaaatgagcagcataaaccctgtcatcctttttcccggcgccctgaac
gccagggcaaccgatattgcagccggtttcgtgacatcgctcgtcctgggcgccggccag
ttctgcacaaatcccggcctgatcctcgccatcgacggcgccgcccttgacgcctttgtt
gcacggacagccgagctgcttcgggatgtcgcgcctcaggcaatgctgacgccgtcgatc
gcgaaggcctattgcgatggcgttgccaaactcaggcagcattccgaggtgcgggcagtg
gcatcgggcaggcccggcagcgaatttgaaggcacggcggcgctgttcgagacgacggcg
gacgccttcctcgccaatcaccagcttcaggacgaggtcttcggcgccgccggcctcgtc
gttcgttgccgggatcttcagcagctcgaggcggtgctcgacgagctggaaggccagctc
accgttgcgctccacatcgcggacgaggacgaagccgcagcacgccgactggttcccaag
ctggagatgcttgcaggccggctgctcgtcaatggtttcggaaccggggtggaagtgtct
cctgccatggtccatggcggaccttatccggcaacggcggacggacgttctacatccgtc
ggcactctggcgatatatcggttcctgcggccggtatcttatcaggacttcacgaaggcc
ctgttgccggcagcgcttcgatag

DBGET integrated database retrieval system