KEGG   Ralstonia eutropha JMP134: Reut_A0959Help
Entry
Reut_A0959        CDS       T00268                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00010  Glycolysis / Gluconeogenesis
reu00051  Fructose and mannose metabolism
reu00562  Inositol phosphate metabolism
reu00710  Carbon fixation in photosynthetic organisms
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00002  Glycolysis, core module involving three-carbon compounds
reu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_A0959
   00051 Fructose and mannose metabolism
    Reut_A0959
   00562 Inositol phosphate metabolism
    Reut_A0959
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Reut_A0959
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Reut_A0959
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Reut_A0959
  Exosomal proteins of bladder cancer cells
   Reut_A0959
  Exosomal proteins of melanoma cells
   Reut_A0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAZ60338
UniProt: Q473U5
Position
1:1047775..1048512
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAAPARARLAVCAPFPYLAQCQALLNGSQVAWGA
QDVSAEARGAFTGEVAASMLGEFGCTYALVGHSERRTYHGESDAVVAAKALRALEFGIIP
VICVGETLAQREAGETEVVVGRQLQAALDALSVEQLGRVVLAYEPVWAIGTGKTASSEQA
QAVHAFLRAEVRERDAGVADRMAILYGGSVKPDNAAELFSMSDIDGGLIGGASLKSEDFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaactggaagatgcacggcagcctggcagccaacgct
gcgctgctggaaggtatcaaggctgcacctgcgcgcgcgcggttggcagtctgcgcgcct
ttcccttatcttgcacagtgccaggcgttgctgaatggctcgcaggtagcctggggcgca
caagatgtgtccgccgaggcccgtggcgcgttcaccggcgaggtggccgcgtcgatgctg
ggtgagttcggctgcacgtacgcgctggtcggacactcggagcgccgcacgtaccatggg
gaatccgatgccgtggtagctgccaaagcgctgcgcgcgctggaattcggcatcattccg
gtgatttgcgtcggtgaaacgctcgcccagcgcgaggccggtgaaaccgaagttgtcgtc
ggtcgtcaattgcaggccgctctcgacgcgctgtcggtggagcaactgggtcgtgtggtg
ctggcctacgaaccggtgtgggccatcggtactggcaagaccgcaagcagcgagcaggcg
caggccgtgcatgcgttcttgcgtgcagaggtgcgcgagcgcgacgccggtgtggctgac
cgtatggcgattttgtacggtggcagtgtcaagccggacaatgcggccgaattgttttcc
atgtccgatatcgacgggggcctgattgggggtgcctcgctgaagtcggaagattttctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system