KEGG   Ralstonia eutropha JMP134: Reut_A1304Help
Entry
Reut_A1304        CDS       T00268                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00010  Glycolysis / Gluconeogenesis
reu00020  Citrate cycle (TCA cycle)
reu00620  Pyruvate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
Module
reu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_A1304
   00020 Citrate cycle (TCA cycle)
    Reut_A1304
   00620 Pyruvate metabolism
    Reut_A1304
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Reut_A1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 CAT FAP
Motif
Other DBs
NCBI-ProteinID: AAZ60674
UniProt: Q472K9
Position
1:1397947..1399611
Genome map
AA seq 554 aa AA seqDB search
MSQAIEIKVPDIGDYDAVPVIEVHVKPGDSINAEDALVTLESDKATMDVPSPQAGVVKEV
RIKVGDNVSEGSVLVMLEAAGAAAPAPAPAVAAPAPAPAQAAAPAPAPAAAPAPAAAPAA
GGTIEVKVPDIGDYDAVPVIEVHVKPGDTINPEDAVVTLESDKATMDVPSPQGGVVKEVK
VKVGDNVSEGTLLILLEGAAGAAAPAPAAAAPAPAPAAAPAQAAAPAPVAAAPAPAAAAS
APVGVTGKAAHASPSVRKFARELGVDVSRVPGTGPKNRITQEDVQRYVKGVMTGQAAAPA
QAAAAGGGGGELGLLPWPKVDFTRFGEVESKALSRIKKISGANLHRNWVMIPHVTNHDEA
DITDLEAFRVQLNKENEKSGVKVTMLAFMIKATVAALKKFPNFNASLDGDNLVLKKYFNI
GFAADTPNGLVVPVIKDADKKGVLEISQEMSELAKLARDGKLKPDQMQGGCFSISSLGGI
GGTYFTPIINAPEVAIMGVCKSYMKPVWDGKQFAPRLTLPLSLSWDHRVIDGAEAARFNT
YFGQLLADFRRILL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgattgaaatcaaggtgccggacatcggcgactatgacgccgttcccgtc
attgaagtgcatgtgaaacccggcgacagcatcaatgcggaagacgcgctggtcacgctg
gaatcggacaaggccaccatggacgtgccctcgccgcaggccggcgtggtcaaggaagtc
cgcatcaaggtgggcgacaacgtatccgaaggctccgtgctggtgatgctggaagccgct
ggcgctgccgcgcctgcgccggctcccgcagttgccgcaccggcgcctgcccccgcccag
gctgccgcgcccgcaccggctccggccgctgccccggcgcccgccgctgctccggcagcc
ggcggcaccattgaagtcaaggtgccggatatcggtgattacgacgctgttcccgtgatc
gaagtccacgtgaagccgggcgacacgatcaaccccgaagatgccgtcgtcacgctggaa
tcggacaaggccacgatggacgtgccgtccccgcaaggcggcgtggtcaaggaagtcaag
gtcaaggtcggcgacaacgtgtccgagggcacgctgctgatcctgctggaaggcgccgct
ggcgccgccgcaccggctccggccgctgcagcacccgctccggctcccgcggcagcacct
gcccaggcagcggccccggcgcccgttgccgctgcgccggctccggcagccgccgcctca
gcgcctgtcggcgtgaccggcaaggccgcgcacgcatcgccgtcggtgcgcaagttcgcg
cgcgaactcggtgtggatgtttcccgcgtgccgggcacgggaccgaagaaccgcatcacc
caggaagacgtacagcgctacgtcaagggcgtgatgaccggccaggctgccgcgccggca
caggctgccgcggctggtggcggtggtggcgagcttggcctgctgccgtggccgaaggtc
gatttcacgcgcttcggcgaggtggaaagcaaggccctgtcgcgcatcaagaagatctcg
ggtgcaaacctgcaccgcaactgggtcatgattccacacgtcaccaaccatgacgaagcg
gacatcaccgacctggaagccttccgcgtccaactcaacaaggaaaacgagaagtccggc
gtcaaggtcacgatgctggcgttcatgatcaaggccactgtggcggcgctgaagaagttc
ccgaacttcaatgcctcgctcgacggtgacaacctggtgctgaagaaatacttcaacatc
ggtttcgcggccgatacgccgaacggcctcgtcgtgccggtcatcaaggacgccgacaag
aagggcgtgctcgagatcagccaggaaatgagcgagctggccaagctcgcgcgcgacggc
aagctcaagcccgaccagatgcagggcggctgcttctcgatctcgtcgctgggcggcatc
ggcggcacgtacttcacgccgatcatcaacgcgccggaagtggccatcatgggcgtgtgc
aagtcgtacatgaagccggtctgggacggcaagcagttcgcgccgcgcctgacgctgccg
ctgtcgctgtcgtgggaccaccgcgtcatcgacggcgccgaggcggcccgcttcaatacg
tacttcgggcaactgctggcggacttccgtcgcatccttctctaa

DBGET integrated database retrieval system