KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1726
Entry
Reut_A1726        CDS       T00268                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Reut_A1726
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reu02044]
    Reut_A1726
Secretion system [BR:reu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Reut_A1726
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C
Other DBs
NCBI-ProteinID: AAZ61091
UniProt: Q470U2
Position
1:complement(1862870..1864798)
AA seq 642 aa
MIPATATQSDSFATVTTPFGDDVLLLDGFAGREALSELFSFQLRMRSADKALDASRIVGQ
KVTVRLQRPGGFLRCFNGIVTRFAHTGADPSHAFYSAELAPRLWLLTLARDRRIFQNQSA
LDIIRTVLGEFEVAFDARVTASRYPVREYCVQYDESPLQFISRLMEEEGIFYYFTFSDGA
HTMVLGDSPSAHAALAHEAELWGGQPGEQAAGLPMLAAFRMEQGLGPANHVLVDYDYVQA
QTSQGSAQPDSSAPGARQYIFPGRHKDASDAARKAAVRVAAQQVEARSGSGESNCHGLAA
GSTFTLNGHVNAALNAEYVVRAVEHSVAGSHYANSFTVFPLAVPFRAPLVTPRPLVAGTH
TATVVGSQGEEIWTDQHGRIKLKFHWDQAPGADQDSSCWVRVAQGMAGQGWGHLFLPRVG
QEVVVSYVDGDPDRPLVTGSVYNGQVTPPVTLPSMQTQSVIRSRTSKNGSAGNELRMEDK
AGAEELYLHAQRDMNVAVENKLSTTVVGAGESHVVQKGDRLVEVQSGNETHKVSGTRSLE
VTGDETRTNGAAFTQEVSGAYKLKVSGDLVIDVTGAITIKSAGSVAIEAGTSLSNKAGTT
LANKAGTTLSGEGLTVQQKASASHTVESGGMLELKGAMVKLN
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgattccggccaccgccacccagtccgacagcttcgccacggtcaccacgccgtttggc
gacgatgtgctgctgctcgacggatttgccgggcgcgaggcgctttccgagctgttttcc
ttccagctgcgcatgcgctcggcggacaaggcgctcgatgccagccgcatcgttggccag
aaggtcacggtcaggctccagcggccgggcggcttcctgcgttgtttcaacggcatcgtg
acgcgcttcgcccataccggcgccgaccccagccacgcgttctacagcgccgagctggcg
ccgcgcctgtggctgctgacgctggcgcgcgaccgcaggatcttccagaaccagagcgcg
ctcgacatcatccgcaccgtgctgggcgagttcgaggtggcattcgacgcgcgcgtcacc
gcttcgcgctacccggtgcgcgagtactgcgtgcagtacgacgaaagccccctgcagttc
atctcgcggctgatggaggaagagggcatcttctactacttcaccttttccgacggcgcg
cacaccatggtgctgggtgacagtccctcggcccacgccgcgctggcccacgaggccgag
ctgtggggcggccagccgggcgagcaggcggcgggcctgccgatgctggcggccttccgc
atggaacagggactcggtccggccaaccacgtgctggtcgactatgactatgtgcaggcg
cagaccagccagggcagtgcgcagccggactcgagcgcgcccggcgcgcgccagtacatt
ttcccggggcgccacaaggatgcctcggatgccgcgcgcaaggcggcggtgcgagtggcc
gcacagcaggtcgaggctcgctccggcagcggcgagagcaactgtcacggccttgccgca
gggagtaccttcaccctcaacggccacgtcaatgcggcactgaacgccgagtacgtggtg
cgcgcggtcgagcactcggtggccggcagccactatgccaacagcttcacggtgtttccg
ctggcggtgccattccgcgcgccgctggtaacgccgcgtccgctggtggccggcacccat
accgcaaccgtggtcggctcccagggcgaggaaatctggacggaccagcacggccgtatc
aagctcaagttccactgggaccaggcgcccggcgccgaccaggacagctcgtgctgggtc
cgggtggcgcagggcatggctggccagggctggggccatctgttcctgccacgcgtgggg
caggaggtggtagtcagctatgtcgacggcgatcccgaccggccgctggtgaccggcagc
gtctacaacggccaggtgacgccgccggtgacgcttccctcgatgcagacccagagcgtg
atccgctcgcgcacttccaagaacggcagcgccggcaacgagctgcgcatggaggacaag
gccggcgccgaagagctctacctgcacgcgcagcgcgacatgaacgtggcggtggaaaac
aagctgtccaccaccgtggtcggcgctggcgagtcgcatgttgtccagaagggtgaccgg
ctggtcgaggtgcagtcgggcaacgaaactcacaaggtgagcggcacccgtagcctcgag
gtgaccggtgacgagacccgcaccaacggcgccgccttcacccaggaggtcagcggggcc
tacaagctcaaggtgtctggcgatctggtcatcgacgtgacgggcgccatcaccatcaag
tcggcaggctcggtggcgattgaggctggcacttcgctgagcaacaaggcgggcaccacg
ctggcaaacaaggcaggcactacgctgagtggcgagggcctgaccgtgcagcagaaggcg
tcggcctcgcacacggtggaaagcggcggcatgctggagctcaagggcgccatggtgaaa
ctgaactga

DBGET integrated database retrieval system