KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1729Help
Entry
Reut_A1729        CDS       T00268                                 

Definition
(GenBank) Protein of unknown function DUF879, bacterial
  KO
K11896  type VI secretion system protein ImpG
Organism
reu  Cupriavidus pinatubonensis JMP134
Brite
KEGG Orthology (KO) [BR:reu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reu02044]
    Reut_A1729
Secretion system [BR:reu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Reut_A1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF DUF4214
Motif
Other DBs
NCBI-ProteinID: AAZ61094
UniProt: Q470T9
Position
1:complement(1868540..1870300)
Genome map
AA seq 586 aa AA seqDB search
MAELGEGDILHYYKRELSYLRTQGAAFAERYPMVASRLALHGTESLDPHTERLIEATAFL
AARVHRDLDQSFPQVASSLLENVCPALVQPLPSMTVVQFALDPSQGKVTAGYRVPRHTGL
QARTEDDQTCRFRTSWETTLWPLTVEQAQFDQDHTLRLTLACADGVDFSELELTTLRLHL
HGDWMVTMPLYELLVSGVAGVRIEPSDGEASLLPASAWREVGYDADEAVLPQPPNAQPAY
GLMQEYFAFPRKFHFFDLALPAGRLGRGTRCDIVLRLARVSRGMARIGAGNFRLGCVPAI
NLFSQTSEPIVLDQRHYEYRLVADQRREAATEIHSVSSVVLSDPASDRTQAVPPVAAASG
DAGADGVYWWTRREPTLRPGLSGTDTYLTFVDAGKTSSQPAAPVAYANVLCTNRRLAEQV
PVGARMLVENVSQNARVRLLYEPTVQRNPPLGGESLWRLVSLLTLHHGTLASGATGRHEV
QQMLRLFAADGSRELEQIRGIRSVQSRGVTAHIGGDAWRGFCRGTEIAIEFDADAFAGGS
PLLMGAVLARFFALYTSVNSFVRLVVRRGDEIWKQWEPMTGCQTLL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctgggcgaaggcgacatcctgcactactacaagcgggagctgtcctatctg
cgtacgcagggcgcggctttcgccgaacgctatcccatggtggcgtcgcgcctggcgctg
cacggcaccgaatcgcttgacccgcataccgaacgcctgatcgaggcgacggccttcctg
gccgcacgtgtgcaccgcgatctcgaccagtcctttccgcaggtcgcttcgtcgctgctg
gagaatgtctgcccggcgctggtgcaaccgctgccctcgatgaccgtggtgcagttcgcg
ctcgacccgagccagggcaaggtcaccgcaggctaccgggtacctcgccataccggactg
caggcccgtaccgaggacgatcagacctgccgcttccgcaccagctgggaaacgacgctg
tggccgctgacggtcgagcaggcccagttcgaccaggaccataccctgcgcctgacgctt
gcctgtgccgacggtgtcgacttctcggagctggaactcaccacgctgcgcctgcacctg
cacggcgactggatggtgacgatgccgctttacgaactgctggtgagcggggtggccggc
gtgcgcatcgagccgagcgacggcgaggcctcgctgctgccggcttcggcctggcgcgag
gtcggctacgatgccgacgaggccgtgctgccgcagccgcccaatgcgcaaccggcttat
gggttgatgcaggagtacttcgcctttccgcgcaagttccacttcttcgatctggcgttg
cccgcgggccggcttgggcgcggcacgcgctgcgatatcgtgctgcgtctggcgcgagtg
tcgcgcggcatggcgcgcattggcgccggcaatttccgcctgggctgcgtgccggccatc
aacttgttctcgcagaccagtgagccgatcgtgctcgaccagcgtcactacgagtaccgg
ctggtggcggaccagcggcgcgaggccgccaccgagatccattcggtcagctcggtggtg
ctgtccgatccggccagcgatcgaacccaggctgtgccaccagttgccgcggccagcggc
gacgcgggtgccgacggcgtgtactggtggacccgccgcgagccgacccttcggcccggc
ctgtccggcaccgacacctacctgacctttgtcgatgcgggcaagacaagcagccagccg
gcagcgccagtcgcctatgccaacgtgctttgcaccaaccggcgcctggccgagcaggtc
ccggtgggcgcgcgcatgctggtggaaaacgtttcgcagaacgcgcgcgtgcgtttgctg
tacgagccgacggttcagcgcaatccgccgctgggcggcgaatcgctgtggcggcttgtg
tcgttgctgacgctgcatcacggcacgctggcaagcggtgccaccggtcgccacgaggtg
cagcagatgctgcgcctgttcgccgccgacggcagccgcgaattggaacagatccgtggc
atacgcagcgtgcaatcgcgcggtgtcaccgcacatatcggcggggatgcctggcgcggc
ttctgccgtggcaccgagatcgccatcgagttcgatgccgacgcctttgcagggggatcg
ccgctgttgatgggcgccgtgctggcgcgcttctttgcgttgtacacctcggtcaattcc
tttgtgcggctggtggtgcgccgcggagacgagatatggaagcaatgggagccgatgacc
ggctgccagacgctgctgtga

DBGET integrated database retrieval system