KEGG   Ralstonia eutropha JMP134: Reut_A2046Help
Entry
Reut_A2046        CDS       T00268                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00310  Lysine degradation
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_A2046
  Amino acid metabolism
   00310 Lysine degradation
    Reut_A2046
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Reut_A2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAZ61410
UniProt: Q46ZM3
Position
1:complement(2245791..2247050)
Genome map
AA seq 419 aa AA seqDB search
MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLSQI
IKNDGDTVVADELIAKIDTEATAGAAAPAAAAPAPAAAAPAAAAAAAPAAAGAVAMPSAA
KLMAEAGLSAGQVAGTGKDGRITKGDVLGASAAPAPAPAAKAAPAPAAAKPALPQVAANV
DFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRNKYKDRFEK
EHGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRN
ADQMSLADIEKKIAEFGAKARDGKLSLEELTGGTFSISNGGTFGSMLSTPIINPPQSAIL
GVHATKDRAVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgacgtcaaggttccgcaactgtccgaatcggtcgccgaagcgaccatg
ctgaactggaagaagaagcctggcgaagccgtcgcccaggacgagatcctgatcgagatc
gagaccgacaaggtcgtgctggaagtgccggcaccgtcggccggcgtgctgtcgcagatc
atcaagaacgacggcgacaccgtcgtggccgatgaactgatcgccaagatcgacaccgaa
gccaccgctggcgctgcggctcccgccgccgccgcaccggctccggccgctgccgcaccg
gctgctgccgccgctgctgcgccggccgccgctggcgcagtcgccatgccgtcggctgcc
aagctgatggccgaagccggcctgtcggctggccaggtcgccggcaccggcaaggatggc
cgcatcaccaagggcgacgtgctgggcgcttcggctgctccggcacccgcaccggccgcc
aaggcggcgccggcacccgccgccgccaagccggccctgccgcaagttgctgccaatgtg
gacttcgccgcgctgggcgaccgtccggaagagcgcgtgccgatgagccgcctgcgcgcc
cgtatcgccgagcgcctggtgcagtcgcaatcgaccaacgccatcctcaccaccttcaat
gaagtgaacatgaagccggtgatggatctgcgcaacaagtacaaggaccgcttcgagaag
gaacacggcgtgaagctcggcttcatgtcgttcttcgtgaaggccgctgtccacgcgctg
aagaagtacccggtcatcaacgcgtcggtcgacggcaacgacatcgtttaccacggttac
ttcgacatcggtatcgctgtcggctcgccgcgtggcctggtggtgccgattctgcgcaac
gccgaccagatgagcctggccgacatcgagaagaagatcgccgagttcggcgccaaggcc
cgcgacggcaagctgtcgctggaagaactgaccggcggtacgttctcaatctcgaacggc
ggcacgttcggttcgatgctgtcgactccgatcatcaacccgccgcaatcggccatcctg
ggcgtgcacgcgaccaaggatcgcgccgtggtggaagacggccagatcgtgatccgtccg
atgaactacctggccatgtcgtatgaccaccgcatcatcgatggccgcgaagccgtgctg
ggcctggtggcgatgaaggaagcgctggaagatccggcccgcctgctgctggacctgtaa

DBGET integrated database retrieval system