KEGG   Ralstonia eutropha JMP134: Reut_A2229Help
Entry
Reut_A2229        CDS       T00268                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00010  Glycolysis / Gluconeogenesis
reu00620  Pyruvate metabolism
reu00640  Propanoate metabolism
reu00680  Methane metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_A2229
   00620 Pyruvate metabolism
    Reut_A2229
   00640 Propanoate metabolism
    Reut_A2229
  Energy metabolism
   00680 Methane metabolism
    Reut_A2229
Enzymes [BR:reu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Reut_A2229
Lipid biosynthesis proteins [BR:reu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Reut_A2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAZ61592
UniProt: Q46Z41
Position
1:complement(2459563..2461545)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVMQEHRVFNPPESFVRQAAIPGMDAYRALCAEAERDYEGFWASRARDLLHWNKP
FTKVLDESNAPFYKWFEDGELNASYNCLDRNLQNGNADKTAIVFEADDGTATRVSYRDLH
AKVCRFANGLKALGIKKGDRVVIYMPMSVEGVVAMQACARLGATHSVVFGGFSAKSLQER
LVDVGAVALITADEQMRGGKALPLKAIADDALALGGCEAVKNVIVYRRTGGKVNWVEGRD
RWMEDVSAGQPDTCEAVPVSAEHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMQWTFD
IKPDDLFWCTADIGWVTGHTYIAYGPLAAGATQIIFEGVPTYPNAGRFWDMIARHKVSIF
YTAPTAIRSLIKAAEADEKIHPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGNERCPIV
DTFWQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGHDVPNGSGGILVVKRPW
PAMIRTIWGDPERFKKSYFPEELGGKLYLAGDGSIRDKETGYFTIMGRIDDVLNVSGHRM
GTMEIESALVANPIVAEAAVVGRPDDTTGEAICAFVVLKRARPSDAEAQQIATELRNWVA
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEEITQDTSTLENPAILDQLKQAQ
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcgaatcggtgatgcaagagcatcgcgttttcaacccgcccgagtccttc
gtccggcaagccgcgattccaggcatggacgcctaccgcgcgctgtgcgccgaggcggag
cgcgactacgagggcttctgggccagccgtgcgcgcgacctgctgcactggaacaagccc
ttcaccaaggtgctggatgaaagcaatgcaccgttctacaagtggttcgaggatggcgaa
ctgaacgcttcgtacaactgcctggaccgcaacctgcagaacggcaatgccgacaagacc
gcgatcgtgttcgaggccgacgacggcaccgcgacgcgcgtgtcgtatcgcgacctgcac
gccaaggtctgccgcttcgccaatggcctgaaggcgcttggcatcaagaagggcgatcgc
gtggtgatctacatgccgatgtcggtcgaaggcgtggtggccatgcaggcgtgcgcgcgt
ctaggtgccacgcattctgtggtgttcggcgggttctcggccaagtcgctgcaggagcgg
ctggtggacgtcggcgccgtggcgctgatcaccgcggacgagcagatgcgcggcggcaag
gcgctaccgctcaaggcgattgccgacgatgcgctggcgctcggcggctgcgaggcggtc
aaaaacgtgatcgtctatcgccgcaccggcggcaaggtcaactgggtcgaaggccgtgac
cgctggatggaagacgtatccgccggccagcccgacacctgcgaggccgtgcccgtgagc
gccgagcatccgctgttcgtgctctacacctcgggctccaccggcaagcccaagggcgtg
cagcacagcaccggcggctacctgctgtgggcgctgatgacgatgcagtggaccttcgac
atcaagcccgacgacctgttctggtgtactgccgacatcggctgggtcaccggtcacacc
tatatcgcgtacggcccgctggccgccggtgccacgcagatcatcttcgaaggcgtgccg
acctatccgaacgcaggccgcttctgggacatgatcgcgcgccataaggtcagcatcttc
tacaccgcgccgaccgcgattcgctcgctgatcaaggccgccgaggcagacgagaagatc
catccgaagcagtacgacctttccagcctgcgcctgctcggcaccgtgggcgagccgatc
aaccccgaagcctggatgtggtactacaagaacatcggcaatgagcgctgcccgatcgtc
gatacgttctggcagaccgagaccggtggccacatgattacgccgctgccgggcgccacg
ccgctggtgccgggctcgtgcacgctgccgctgccgggtatcatggcggcgatcgtcgac
gagactggacatgacgtacctaacgggagcggcggcatcctggtggtcaagcgcccgtgg
ccggcgatgatccgcacgatctggggcgatccggaacgcttcaagaagagctacttcccg
gaagaactcggcggcaagctgtacctggccggcgatggctcgatccgcgacaaggagacc
ggctacttcaccatcatgggccgtatcgatgatgtgctgaacgtgtcgggccaccgcatg
ggcacgatggaaatcgaatcggcgctggtcgcgaacccgatcgtggctgaagccgccgtg
gtcggtcgcccggacgacactacgggcgaggccatctgcgcattcgtggtgctcaagcgt
gcgcgtccgagcgatgccgaggcgcagcagatcgccaccgaactgcgcaactgggtcgcg
aaggaaatcggtccgatcgccaagcccaaggacatccgcttcggcgacaacctgccgaag
acgcgctcgggcaagatcatgcgccgcctgctgcgttcgctggccaagggtgaggaaatc
acgcaggacacctcgacgctggagaaccctgcgatccttgatcaattgaagcaggcgcaa
taa

DBGET integrated database retrieval system