KEGG   Cupriavidus pinatubonensis JMP134: Reut_A3329Help
Entry
Reut_A3329        CDS       T00268                                 

Definition
(GenBank) Glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00260  Glycine, serine and threonine metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00670  One carbon pool by folate
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A3329
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Reut_A3329
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Reut_A3329
Enzymes [BR:reu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Reut_A3329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD Nterm_IS4
Motif
Other DBs
NCBI-ProteinID: AAZ62687
UniProt: Q46VZ7
Position
1:3638781..3639908
Genome map
AA seq 375 aa AA seqDB search
MTLQATPLNAIHRALGARMVDFGGWDMPVNYGSQIEEHNAVRSDAGMFDVSHMCVVDLNG
ANTRAFLRGLLANNVDKLQTPGKALYSCMLDEKGGVIDDLIVYFFAEDRFRLVVNASTAL
GDIEWIRARNDATGSGVTITPRRGDVAPAGALPLAIVAVQGPNARTKVWNTFPSTQPSDA
LKPFNAVVVHDPAIGEIMVARTGYTGEDGFELVVPAENVAAVWEKLDAAGVRPAGLGARD
TLRLEAGMNLYGQDMDINTSPLDAGLAWTVDLQSERDFTGKAALAAAGQRQQFLGLILRD
KGGVLRAHQKVVTAAGDGEITSGTFSPSLSQSIAFARLPMGVAVGDTVQVEIRDRKLAAT
VVKLPFVRNGKALVS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccaggccacgcccctcaatgccatccaccgcgccctcggcgcccgcatggtc
gacttcggcggctgggacatgccggtcaactacggctcccagatcgaggaacacaacgcg
gtgcgcagcgacgccggcatgttcgatgtgtcgcatatgtgcgtggtcgacctgaacggc
gccaatacgcgtgcgttcctgcgcggcctgctggccaacaacgtcgataagctgcagacg
ccgggcaaggctttgtattcctgcatgctcgacgaaaaaggcggcgtgatcgacgacctg
atcgtctacttcttcgccgaggatcgcttccgcctggtggtcaatgccagcaccgcgctt
ggcgatatcgagtggatccgcgcacgcaatgacgcgaccggcagcggcgtgaccatcacc
ccgcgccgtggcgatgtggcaccggcgggcgcgctgccgctggcgattgtcgccgtgcag
ggcccgaacgcgcgcaccaaggtgtggaacaccttcccgtccacccagccttccgacgct
ctcaagccattcaacgccgtcgtggtccacgacccggccatcggcgagatcatggtcgcg
cgcaccggctacaccggcgaagacggctttgaactcgtggtgcctgccgagaacgtcgct
gccgtgtgggaaaagctcgatgccgccggcgtgcgcccggccggcctcggcgcgcgcgac
acgctgcgcctggaagccggcatgaacctgtacggccaggacatggatatcaacacctcg
ccgctcgacgccggcctggcctggaccgtcgacctgcagagcgagcgcgatttcaccggc
aaggcggcgcttgccgccgccggccagcgccagcagttcctgggcctgatcctgcgtgac
aagggcggcgtgctgcgcgcgcaccagaaggtcgtcaccgcggccggtgatggcgaaatc
acgagcggcaccttcagcccgtcgctgtcgcaatcgatcgctttcgcgcgcctgccgatg
ggcgtggcggtcggcgacacggtgcaggtggagatccgcgaccgcaaactcgcggcgact
gtggttaaactgccgtttgtgcgtaatggcaaggcactcgtgagctga

DBGET integrated database retrieval system