KEGG   Cupriavidus pinatubonensis JMP134: Reut_A3388Help
Entry
Reut_A3388        CDS       T00268                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00790  Folate biosynthesis
reu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Reut_A3388
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_A3388
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Reut_A3388
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A3388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AAZ62746
UniProt: Q46VT8
Position
1:3715377..3715736
Genome map
AA seq 119 aa AA seqDB search
MPACPPGRAGFFFSLIEPTMTPLSPQARATLLAELPGWTDVDNRDAIQKRFTFPDFNAAF
AFMTRVAIQAEKADHHPEWFNVYNRVDITLSTHDANGLTQRDIDLAHFIERAAASLRVE
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgccggcatgcccgccagggcgggccggttttttcttttcactgatcgagcccactatg
acacctctctcgccccaggcgcgcgccaccctgctcgccgaactgcccggctggaccgac
gtcgacaaccgcgacgcaatccagaagcgtttcaccttccccgatttcaacgccgcattc
gcgtttatgacacgcgtggccatccaggctgaaaaggcggaccaccaccccgagtggttc
aacgtctacaaccgcgtcgacatcacgctgtcgacccacgacgcaaacggcctgacccag
cgcgatatcgacctggcccacttcattgagcgcgcggcggcctcgctgcgcgtggagtaa

DBGET integrated database retrieval system