KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3530Help
Entry
Reut_B3530        CDS       T00268                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, catalytic region:D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00270  Cysteine and methionine metabolism
reu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Reut_B3530
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     Reut_B3530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AAZ62888
UniProt: Q46VE6
Position
2:76223..77161
Genome map
AA seq 312 aa AA seqDB search
MMKRICISEFMDPAAVQALTPGFDVRYEPGWVDQRGALLDALAGADALIVRNRTQVDAAL
LERAPALRVVGRLGVGLDNIDVAACRDRGIRVIPASGANARSVAEYVVTTAALLLRGAYL
GSAEVAGGKWPRARLSEGREALGKTLGLIGFGDIGRQAAALAQAFGMRVVAHDPMLAPDD
PVWSATGVVCMTLDALLAQSDAVSLHVPLVAATRHLMNAQRIGAMKRGAVLINTARGGVV
DEGALAGALLEGHLAGAALDVFEAEPLPADSVLADVPNLVLTPHIGGVTREANARVSMMI
AEKVRQTLEALP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcgcatctgcatcagcgagttcatggacccggccgcggtgcaggcgctcacg
cccggcttcgacgtgcgctacgagccgggctgggtggaccagcgcggcgccttgctcgac
gcgctggccggtgcggatgcgctgatcgtgcgcaaccgcacccaggtcgacgcggcgctg
cttgagcgggcgcccgcgctgcgcgtggtcggccggcttggcgtggggctcgacaatatc
gatgtcgcagcatgccgtgaccgcggtatccgcgtgattccggcgagtggcgcaaatgcg
cgatccgttgccgagtacgtggtgaccacggcggcgctgctgctgcgtggcgcgtatctc
ggcagcgccgaggtagccggcggcaagtggccgcgtgcccgcttgtcggaagggcgcgag
gccttgggcaagacgctgggcctgattggcttcggcgatatcggccggcaggccgccgcg
ctcgcgcaggcgttcggcatgcgagtcgtcgcgcatgatccgatgctcgcaccagacgat
ccggtctggtcagctaccggcgtggtgtgcatgacgctggatgccttgctggcccaatcc
gatgcggtaagcctgcatgttccgcttgtggcggccacacggcacctgatgaacgcgcag
cgcattggcgcgatgaagcggggcgccgtgctgatcaacacggcgcgtggcggcgtggtg
gacgagggcgcgctggctggcgccttgctcgaagggcaccttgccggcgcggcgctggac
gtgttcgaggcagagccgctacccgcggacagcgtgctcgcagacgtgccgaacctggtg
ttgactccgcatatcggcggcgtcacgcgtgaggccaatgcgcgcgtgtcgatgatgatt
gccgagaaggtgcggcaaacgctggaggcgctgccatga

DBGET integrated database retrieval system